GPR172A(SLC52A2) (NM_024531) Human Tagged ORF Clone

CAT#: RC202512

SLC52A2 (Myc-DDK-tagged)-Human G protein-coupled receptor 172A (GPR172A)

Change vector?

  • TrueORF®

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GPR172A(SLC52A2) (NM_024531) Human Tagged ORF Clone
Symbol SLC52A2
Synonyms BVVLS2; D15Ertd747e; GPCR41; GPR172A; hRFT3; PAR1; RFT3; RFVT2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202512 representing NM_024531
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCACCCACGCCCGCCCGTCCGGTGCTGACCCACCTGCTGGTGGCTCTCTTCGGCATGGGCTCCT
GGGCTGCGGTCAATGGGATCTGGGTGGAGCTACCTGTGGTGGTCAAAGAGCTTCCAGAGGGTTGGAGCCT
CCCCTCTTACGTCTCTGTGCTTGTGGCTCTGGGGAACCTGGGTCTGCTGGTGGTGACCCTCTGGAGGAGG
CTGGCCCCAGGAAAGGACGAGCAGGTCCCCATCCGGGTGGTGCAGGTGCTGGGCATGGTGGGCACAGCCC
TGCTGGCCTCTCTGTGGCACCATGTGGCCCCAGTGGCAGGACAGTTGCATTCTGTGGCCTTCTTAGCACT
GGCCTTTGTGCTGGCACTGGCATGCTGTGCCTCGAATGTCACTTTCCTGCCCTTCTTGAGCCACCTGCCA
CCTCGCTTCTTACGGTCATTCTTCCTGGGTCAAGGCCTGAGTGCCCTGCTGCCCTGCGTGCTGGCCCTAG
TGCAGGGTGTGGGCCGCCTCGAGTGCCCGCCAGCCCCCATCAACGGCACCCCTGGCCCCCCGCTCGACTT
CCTTGAGCGTTTTCCCGCCAGCACCTTCTTCTGGGCACTGACTGCCCTTCTGGTCGCTTCAGCTGCTGCC
TTCCAGGGTCTTCTGCTGCTGTTGCCGCCACCACCATCTGTACCCACAGGGGAGTTAGGATCAGGCCTCC
AGGTGGGAGCCCCAGGAGCAGAGGAAGAGGTGGAAGAGTCCTCACCACTGCAAGAGCCACCAAGCCAGGC
AGCAGGCACCACCCCTGGTCCAGACCCTAAGGCCTATCAGCTTCTATCAGCCCGCAGTGCCTGCCTGCTG
GGCCTGTTGGCCGCCACCAACGCGCTGACCAATGGCGTGCTGCCTGCCGTGCAGAGCTTTTCCTGCTTAC
CCTACGGGCGTCTGGCCTACCACCTGGCTGTGGTGCTGGGCAGTGCTGCCAATCCCCTGGCCTGCTTCCT
GGCCATGGGTGTGCTGTGCAGGTCCTTGGCAGGGCTGGGCGGCCTCTCTCTGCTGGGCGTGTTCTGTGGG
GGCTACCTGATGGCGCTGGCAGTCCTGAGCCCCTGCCCGCCCCTGGTGGGCACCTCGGCGGGGGTGGTCC
TCGTGGTGCTGTCGTGGGTGCTGTGTCTTGGCGTGTTCTCCTACGTGAAGGTGGCAGCCAGCTCCCTGCT
GCATGGCGGGGGCCGGCCGGCATTGCTGGCAGCCGGCGTGGCCATCCAGGTGGGCTCTCTGCTCGGCGCT
GTTGCTATGTTCCCCCCGACCAGCATCTATCACGTGTTCCACAGCAGAAAGGACTGTGCAGACCCCTGTG
ACTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202512 representing NM_024531
Red=Cloning site Green=Tags(s)

MAAPTPARPVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNLGLLVVTLWRR
LAPGKDEQVPIRVVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFVLALACCASNVTFLPFLSHLP
PRFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPINGTPGPPLDFLERFPASTFFWALTALLVASAAA
FQGLLLLLPPPPSVPTGELGSGLQVGAPGAEEEVEESSPLQEPPSQAAGTTPGPDPKAYQLLSARSACLL
GLLAATNALTNGVLPAVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLGGLSLLGVFCG
GYLMALAVLSPCPPLVGTSAGVVLVVLSWVLCLGVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGA
VAMFPPTSIYHVFHSRKDCADPCDS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024531
ORF Size 1335 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024531.1, NM_024531.2, NM_024531.3, NM_024531.4, NP_078807
RefSeq Size 1952
RefSeq ORF 1338
Locus ID 79581
Cytogenetics 8q24.3
Protein Families GPCR, Transmembrane, Druggable Genome
MW 45.6 kDa
Gene Summary This gene encodes a membrane protein which belongs to the riboflavin transporter family. In humans, riboflavin must be obtained by intestinal absorption because it cannot be synthesized by the body. The water-soluble vitamin riboflavin is processed to the coenzymes flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) which then act as intermediaries in many cellular metabolic reactions. Paralogous members of the riboflavin transporter gene family are located on chromosomes 17 and 20. Unlike other members of this family, this gene has higher expression in brain tissue than small intestine. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. Mutations in this gene have been associated with Brown-Vialetto-Van Laere syndrome 2 - an autosomal recessive progressive neurologic disorder characterized by deafness, bulbar dysfunction, and axial and limb hypotonia. [provided by RefSeq, Jul 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.