ANGPTL2(ANGPTL2) (NM_012098) Human Tagged ORF Clone

CAT#: RC201917

ANGPTL2 (Myc-DDK-tagged)-Human angiopoietin-like 2 (ANGPTL2)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ANGPTL2(ANGPTL2) (NM_012098) Human Tagged ORF Clone
Symbol ANGPTL2
Synonyms ARP2; HARP
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201917 representing NM_012098
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCCACTGTGCGTGACATGCTGGTGGCTCGGACTGCTGGCTGCCATGGGAGCTGTTGCAGGCCAGG
AGGACGGTTTTGAGGGCACTGAGGAGGGCTCGCCAAGAGAGTTCATTTACCTAAACAGGTACAAGCGGGC
GGGCGAGTCCCAGGACAAGTGCACCTACACCTTCATTGTGCCCCAGCAGCGGGTCACGGGTGCCATCTGC
GTCAACTCCAAGGAGCCTGAGGTGCTTCTGGAGAACCGAGTGCATAAGCAGGAGCTAGAGCTGCTCAACA
ATGAGCTGCTCAAGCAGAAGCGGCAGATCGAGACGCTGCAGCAGCTGGTGGAGGTGGACGGCGGCATTGT
GAGCGAGGTGAAGCTGCTGCGCAAGGAGAGCCGCAACATGAACTCGCGGGTCACGCAGCTCTACATGCAG
CTCCTGCACGAGATCATCCGCAAGCGGGACAACGCGTTGGAGCTCTCCCAGCTGGAGAACAGGATCCTGA
ACCAGACAGCCGACATGCTGCAGCTGGCCAGCAAGTACAAGGACCTGGAGCACAAGTACCAGCACCTGGC
CACACTGGCCCACAACCAATCAGAGATCATCGCGCAGCTTGAGGAGCACTGCCAGAGGGTGCCCTCGGCC
AGGCCCGTCCCCCAGCCACCCCCCGCTGCCCCGCCCCGGGTCTACCAACCACCCACCTACAACCGCATCA
TCAACCAGATCTCTACCAACGAGATCCAGAGTGACCAGAACCTGAAGGTGCTGCCACCCCCTCTGCCCAC
TATGCCCACTCTCACCAGCCTCCCATCTTCCACCGACAAGCCGTCGGGCCCATGGAGAGACTGCCTGCAG
GCCCTGGAGGATGGCCACGACACCAGCTCCATCTACCTGGTGAAGCCGGAGAACACCAACCGCCTCATGC
AGGTGTGGTGCGACCAGAGACACGACCCCGGGGGCTGGACCGTCATCCAGAGACGCCTGGATGGCTCTGT
TAACTTCTTCAGGAACTGGGAGACGTACAAGCAAGGGTTTGGGAACATTGACGGCGAATACTGGCTGGGC
CTGGAGAACATTTACTGGCTGACGAACCAAGGCAACTACAAACTCCTGGTGACCATGGAGGACTGGTCCG
GCCGCAAAGTCTTTGCAGAATACGCCAGTTTCCGCCTGGAACCTGAGAGCGAGTATTATAAGCTGCGGCT
GGGGCGCTACCATGGCAATGCGGGTGACTCCTTTACATGGCACAACGGCAAGCAGTTCACCACCCTGGAC
AGAGATCATGATGTCTACACAGGAAACTGTGCCCACTACCAGAAGGGAGGCTGGTGGTATAACGCCTGTG
CCCACTCCAACCTCAACGGGGTCTGGTACCGCGGGGGCCATTACCGGAGCCGCTACCAGGACGGAGTCTA
CTGGGCTGAGTTCCGAGGAGGCTCTTACTCACTCAAGAAAGTGGTGATGATGATCCGACCGAACCCCAAC
ACCTTCCAC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201917 representing NM_012098
Red=Cloning site Green=Tags(s)

MRPLCVTCWWLGLLAAMGAVAGQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQQRVTGAIC
VNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVKLLRKESRNMNSRVTQLYMQ
LLHEIIRKRDNALELSQLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSA
RPVPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQ
ALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLG
LENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLD
RDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPN
TFH

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012098
ORF Size 1482 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012098.1, NM_012098.2, NP_036230
RefSeq Size 3572
RefSeq ORF 1482
Locus ID 23452
Cytogenetics 9q33.3
Domains FBG
Protein Families Secreted Protein, ES Cell Differentiation/IPS, Druggable Genome
MW 57.1 kDa
Gene Summary Induces sprouting in endothelial cells through an autocrine and paracrine action. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)