UMPS (NM_000373) Human Tagged ORF Clone

CAT#: RC201324

UMPS (Myc-DDK-tagged)-Human uridine monophosphate synthetase (UMPS), transcript variant 1

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name UMPS (NM_000373) Human Tagged ORF Clone
Symbol UMPS
Synonyms OPRT
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201324 representing NM_000373
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGTCGCTCGTGCAGCTTTGGGGCCATTGGTGACGGGTCTGTACGACGTGCAGGCTTTCAAGTTTG
GGGACTTCGTGCTGAAGAGCGGGCTTTCCTCCCCCATCTACATCGATCTGCGGGGCATCGTGTCTCGACC
GCGTCTTCTGAGTCAGGTTGCAGATATTTTATTCCAAACTGCCCAAAATGCAGGCATCAGTTTTGACACC
GTGTGTGGAGTGCCTTATACAGCTTTGCCATTGGCTACAGTTATCTGTTCAACCAATCAAATTCCAATGC
TTATTAGAAGGAAAGAAACAAAGGATTATGGAACTAAGCGTCTTGTAGAAGGAACTATTAATCCAGGAGA
AACCTGTTTAATCATTGAAGATGTTGTCACCAGTGGATCTAGTGTTTTGGAAACTGTTGAGGTTCTTCAG
AAGGAGGGCTTGAAGGTCACTGATGCCATAGTGCTGTTGGACAGAGAGCAGGGAGGCAAGGACAAGTTGC
AGGCGCACGGGATCCGCCTCCACTCAGTGTGTACATTGTCCAAAATGCTGGAGATTCTCGAGCAGCAGAA
AAAAGTTGATGCTGAGACAGTTGGGAGAGTGAAGAGGTTTATTCAGGAGAATGTCTTTGTGGCAGCGAAT
CATAATGGTTCTCCCCTTTCTATAAAGGAAGCACCCAAAGAACTCAGCTTCGGTGCACGTGCAGAGCTGC
CCAGGATCCACCCAGTTGCATCGAAGCTTCTCAGGCTTATGCAAAAGAAGGAGACCAATCTGTGTCTATC
TGCTGATGTTTCACTGGCCAGAGAGCTGTTGCAGCTAGCAGATGCTTTAGGACCTAGTATCTGCATGCTG
AAGACTCATGTAGATATTTTGAATGATTTTACTCTGGATGTGATGAAGGAGTTGATAACTCTGGCAAAAT
GCCATGAGTTCTTGATATTTGAAGACCGGAAGTTTGCAGATATAGGAAACACAGTGAAAAAGCAGTATGA
AGGAGGTATCTTTAAAATAGCTTCCTGGGCAGATCTAGTAAATGCTCACGTGGTGCCAGGCTCAGGAGTT
GTGAAAGGCCTGCAAGAAGTGGGCCTGCCTTTGCATCGGGGGTGCCTCCTTATTGCGGAAATGAGCTCCA
CCGGCTCCCTGGCCACTGGGGACTACACTAGAGCAGCGGTTAGAATGGCTGAGGAGCACTCTGAATTTGT
TGTTGGTTTTATTTCTGGCTCCCGAGTAAGCATGAAACCAGAATTTCTTCACTTGACTCCAGGAGTTCAG
TTGGAAGCAGGAGGAGATAATCTTGGCCAACAGTACAATAGCCCACAAGAAGTTATTGGCAAACGAGGTT
CCGATATCATCATTGTAGGTCGTGGCATAATCTCAGCAGCTGATCGTCTGGAAGCAGCAGAGATGTACAG
AAAAGCTGCTTGGGAAGCGTATTTGAGTAGACTTGGTGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201324 representing NM_000373
Red=Cloning site Green=Tags(s)

MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDT
VCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQ
KEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAAN
HNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICML
KTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGV
VKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000373
ORF Size 1440 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000373.1, NM_000373.2, NM_000373.3, NP_000364
RefSeq Size 2244
RefSeq ORF 1443
Locus ID 7372
Cytogenetics 3q21.2
Domains Pribosyltran, OMPdecase
Protein Families Druggable Genome
Protein Pathways Pyrimidine metabolism, Drug metabolism - other enzymes, Metabolic pathways
MW 52 kDa
Gene Summary This gene encodes a uridine 5'-monophosphate synthase. The encoded protein is a bifunctional enzyme that catalyzes the final two steps of the de novo pyrimidine biosynthetic pathway. The first reaction is carried out by the N-terminal enzyme orotate phosphoribosyltransferase which converts orotic acid to orotidine-5'-monophosphate. The terminal reaction is carried out by the C-terminal enzyme OMP decarboxylase which converts orotidine-5'-monophosphate to uridine monophosphate. Defects in this gene are the cause of hereditary orotic aciduria. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.