DHRS3 (NM_004753) Human Tagged ORF Clone

CAT#: RC201180

Reviews ()
Write a review

DHRS3 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 3 (DHRS3)


  "NM_004753" in other vectors (6)

USD 98.00

USD 470.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name DHRS3 (NM_004753) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DHRS3
Synonyms DD83.1; RDH17; retSDR1; Rsdr1; SDR1; SDR16C1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC201180 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGTGGAAACGGCTGGGCGCGCTGGTGATGTTCCCTCTACAGATGATCTATCTGGTGGTGAAAGCAG
CCGTCGGACTGGTGCTGCCCGCCAAGCTGCGGGACCTGTCGCGGGAGAACGTCCTCATCACCGGCGGCGG
GAGAGGCATCGGGCGTCAGCTCGCCCGCGAGTTCGCGGAGCGCGGCGCCAGAAAGATTGTTCTCTGGGGC
CGGACTGAGAAATGCCTGAAGGAGACGACGGAGGAGATCCGGCAGATGGGCACTGAGTGCCATTACTTCA
TCTGTGATGTGGGCAACCGGGAGGAGGTGTACCAGACGGCCAAGGCCGTCCGGGAGAAGGTGGGTGACAT
CACCATCCTGGTGAACAATGCCGCCGTGGTCCATGGGAAGAGCCTAATGGACAGTGATGATGATGCCCTC
CTCAAGTCCCAACACATCAACACCCTGGGCCAGTTCTGGACCACCAAGGCCTTCCTGCCGCGTATGCTGG
AGCTGCAGAATGGCCACATCGTGTGCCTCAACTCCGTGCTGGCACTGTCTGCCATCCCCGGTGCCATCGA
CTACTGCACATCCAAAGCGTCAGCCTTCGCCTTCATGGAGAGCCTGACCCTGGGGCTGCTGGACTGTCCG
GGAGTCAGCGCCACCACAGTGCTGCCCTTCCACACCAGCACCGAGATGTTCCAGGGCATGAGAGTCAGGT
TTCCCAACCTCTTTCCCCCACTGAAGCCGGAGACGGTGGCCCGGAGGACAGTGGAAGCTGTGCAGCTCAA
CCAGGCCCTCCTCCTCCTCCCATGGACAATGCATGCCCTCGTTATCTTGAAAAGCATACTTCCACAGGCT
GCACTCGAGGAGATCCACAAATTCTCAGGAACCTACACCTGCATGAACACTTTCAAAGGGCGGACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201180 protein sequence
Red=Cloning site Green=Tags(s)

MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAERGARKIVLWG
RTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDAL
LKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGLLDCP
GVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVEAVQLNQALLLLPWTMHALVILKSILPQA
ALEEIHKFSGTYTCMNTFKGRT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004753
ORF Size 906 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004753.1, NM_004753.2, NM_004753.3, NM_004753.4, NM_004753.5, NM_004753.6, NP_004744.2
RefSeq Size 1741
RefSeq ORF 909
Locus ID 9249
Cytogenetics 1p36.21
Domains adh_short
Protein Families Druggable Genome, Transmembrane
Protein Pathways Metabolic pathways, Retinol metabolism
MW 33.5 kDa
Gene Summary Short-chain dehydrogenases/reductases (SDRs), such as DHRS3, catalyze the oxidation/reduction of a wide range of substrates, including retinoids and steroids (Haeseleer and Palczewski, 2000 [PubMed 10800688]). [supplied by OMIM, Jun 2009]

Other Versions

Other products for "DHRS3"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-DHRS3 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools