POLR3GL (NM_032305) Human Tagged ORF Clone

CAT#: RC200991

Reviews ()
Write a review

POLR3GL (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide G (32kD)-like (POLR3GL)


Product Datasheet for 'RC200991'


  "NM_032305" in other vectors (6)

Need a mutant or fragment? Switch to a different vector? Get a free quote.

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name POLR3GL (NM_032305) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol POLR3GL
Synonyms flj32422; RPC32HOM
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200991 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAGCCGGGGTGGGGGCCGGGGTCGTGGCCGGGGCCAGTTGACCTTCAACGTGGAGGCCGTGGGCA
TTGGGAAAGGGGATGCTTTGCCCCCACCCACCCTGCAGCCTTCTCCACTCTTCCCTCCCTTGGAGTTCCG
CCCAGTACCTTTGCCCTCAGGCGAGGAAGGGGAATATGTCCTGGCACTGAAGCAAGAGCTACGAGGAGCC
ATGAGGCAGCTCCCCTACTTCATCCGGCCAGCTGTCCCCAAGAGAGATGTGGAGCGTTATTCAGACAAAT
ATCAGATGTCAGGTCCGATTGACAATGCCATCGATTGGAACCCTGATTGGCGGCGTCTACCCCGGGAGCT
AAAGATCCGAGTGCGGAAGCTACAGAAGGAACGGATTACAATTCTGCTCCCCAAGAGGCCCCCTAAGACC
ACAGAAGATAAGGAGGAAACAATACAGAAACTAGAGACCCTGGAGAAGAAGGAAGAAGAAGTAACTTCAG
AGGAGGATGAGGAGAAAGAAGAAGAAGAAGAGAAGGAAGAGGAGGAAGAAGAAGAGTATGATGAAGAAGA
ACATGAAGAGGAAACTGATTACATCATGTCATATTTTGACAATGGAGAGGACTTTGGTGGTGACAGTGAT
GACAATATGGACGAGGCTATATAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200991 protein sequence
Red=Cloning site Green=Tags(s)

MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGA
MRQLPYFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPRELKIRVRKLQKERITILLPKRPPKT
TEDKEETIQKLETLEKKEEEVTSEEDEEKEEEEEKEEEEEEEYDEEEHEEETDYIMSYFDNGEDFGGDSD
DNMDEAIY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_032305
ORF Size 654 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032305.1, NM_032305.2, NP_115681.1
RefSeq Size 1191 bp
RefSeq ORF 657 bp
Locus ID 84265
Cytogenetics 1q21.1
Protein Pathways Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
MW 25.3 kDa
Gene Summary DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. [UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "POLR3GL"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


POLR3GL mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools