UBXN1 (NM_015853) Human Tagged ORF Clone

CAT#: RC200703

UBXN1 (Myc-DDK-tagged)-Human UBX domain protein 1 (UBXN1)

Product Images

Circular map for RC200703

• 

  Western blot validation of overexpression lysate (Cat# LY402462) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200703 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified UBXN1 protein (Cat# TP300703). The protein was produced from HEK293T cells transfected with UBXN1 cDNA clone (Cat# RC200703) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: UBXN1
• Synonyms: 2B28; SAKS1; UBXD10
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200703 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGAGCTGACGGCTCTTGAGAGTCTCATCGAGATGGGCTTCCCCAGGGGACGCGCGGAGAAGGCTC
  TGGCCCTCACAGGGAACCAGGGCATCGAGGCTGCGATGGACTGGCTGATGGAGCACGAAGACGACCCCGA
  TGTGGACGAGCCTTTAGAGACTCCCCTTGGACATATCCTGGGACGGGAGCCCACTTCCTCAGAGCAAGGC
  GGCCTTGAAGGATCTGGTTCTGCTGCCGGAGAAGGCAAACCCGCTTTGAGTGAAGAGGAAAGACAGGAAC
  AAACTAAGAGGATGTTGGAGCTGGTGGCCCAGAAGCAGCGGGAGCGTGAAGAAAGAGAGGAACGGGAGGC
  ATTGGAACGGGAACGGCAGCGCAGGAGACAAGGGCAAGAGTTGTCAGCAGCACGACAGCGGCTACAGGAA
  GATGAGATGCGCCGGGCTGCTGAGGAGAGGCGGAGGGAAAAGGCCGAGGAGTTAGCAGCCAGACAAAGAG
  TTAGAGAAAAGATCGAGAGGGACAAAGCAGAGAGAGCCAAGAAGTATGGTGGCAGTGTGGGCTCTCAGCC
  ACCCCCAGTGGCACCAGAGCCAGGTCCTGTTCCCTCTTCTCCCAGCCAGGAGCCTCCCACCAAGCGGGAG
  TATGACCAGTGTCGCATACAGGTCAGGCTGCCAGATGGGACCTCACTGACCCAGACGTTCCGGGCCCGGG
  AACAGCTGGCAGCTGTGAGGCTCTATGTGGAGCTCCACCGTGGGGAGGAACTAGGTGGGGGCCAGGACCC
  TGTGCAATTGCTCAGTGGCTTCCCCAGACGGGCCTTCTCAGAAGCTGACATGGAGCGGCCTCTGCAGGAG
  CTGGGTATGGCTGCAAGACTAGAAACCAGGACTAGAAACTGGGGGAGTAGGGAGGCATGCCTAGGAAAAG
  GAGGGATGCAAAGAGAAGGGGCTTTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200703 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHILGREPTSSEQG
  GLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALERERQRRRQGQELSAARQRLQE
  DEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKRE
  YDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQE
  LGMAARLETRTRNWGSREACLGKGGMQREGAL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_015853
• ORF Size: 936 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_015853.5
• RefSeq Size: 1363 bp
• RefSeq ORF: 939 bp
• Locus ID: 51035
• UniProt ID: Q04323
• Cytogenetics: 11q12.3
• Domains: UBA, UBX
• Protein Families: Druggable Genome
• MW: 35.1 kDa
• Gene Summary: Ubiquitin-binding protein that plays a role in the modulation of innate immune response. Blocks both the RIG-I-like receptors (RLR) and NF-kappa-B pathways. Following viral infection, UBXN1 is induced and recruited to the RLR component MAVS. In turn, interferes with MAVS oligomerization, and disrupts the MAVS/TRAF3/TRAF6 signalosome. This function probably serves as a brake to prevent excessive RLR signaling (PubMed:23545497). Interferes with the TNFalpha-triggered NF-kappa-B pathway by interacting with cellular inhibitors of apoptosis proteins (cIAPs) and thereby inhibiting their recruitment to TNFR1 (PubMed:25681446). Prevents also the activation of NF-kappa-B by associating with CUL1 and thus inhibiting NF-kappa-B inhibitor alpha/NFKBIA degradation that remains bound to NF-kappa-B (PubMed:28152074). Interacts with the BRCA1-BARD1 heterodimer and regulates its activity. Specifically binds 'Lys-6'-linked polyubiquitin chains. Interaction with autoubiquitinated BRCA1 leads to the inhibition of the E3 ubiquitin-protein ligase activity of the BRCA1-BARD1 heterodimer (PubMed:20351172). Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulum that are retrotranslocated in the cytosol.[UniProtKB/Swiss-Prot Function]