HNRPUL1 (HNRNPUL1) (NM_007040) Human Tagged ORF Clone

CAT#: RC200576

Reviews ()
Write a review

HNRNPUL1 (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U-like 1 (HNRNPUL1), transcript variant 1



Reconstitution Protocol

USD 784.00

In Stock*

Size
    • 10 ug

Product images

Other products for "HNRNPUL1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HNRNPUL1
Synonyms E1B-AP5; E1BAP5; HNRPUL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200576 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGTGCGCCGTCTGAAGGTGAACGAACTTCGCGAGGAGCTGCAGCGCCGCGGCCTGGACACTCGAG
GCCTCAAGGCCGAGCTTGCTGAGCGGCTGCAGGCGGCGTTGGAGGCCGAGGAGCCTGACGACGAGCGGGA
GCTCGACGCCGACGACGAACCGGGGCGACCCGGGCACATCAACGAGGAGGTCGAGACCGAGGGGGGCTCC
GAGCTGGAGGGGACCGCGCAGCCACCGCCGCCCGGGCTGCAGCCGCACGCGGAGCCCGGCTGCTACTCGG
GGCCGGACGGACATTATGCCATGGACAATATTACCAGGCAGAACCAATTCTACGATACCCAAGTCATCAA
ACAAGAAAACGAGTCAGGCTACGAGAGGAGACCACTGGAAATGGAGCAGCAGCAGGCCTATCGTCCAGAA
ATGAAGACAGAGATGAAGCAAGGAGCACCCACCAGCTTCCTCCCGCCTGAAGCTTCTCAACTCAAGCCAG
ACAGGCAGCAATTCCAGAGTCGAAAGAGGCCTTATGAAGAAAACCGGGGACGGGGGTACTTTGAGCACCG
AGAGGATAGGAGGGGCCGCTCTCCTCAGCCTCCTGCTGAAGAGGATGAAGATGACTTTGATGATACCCTT
GTTGCTATTGACACCTATAACTGCGACCTCCACTTCAAGGTGGCCCGAGATCGGAGTAGTGGCTATCCGC
TCACAATTGAGGGCTTTGCATACCTGTGGTCAGGAGCCCGTGCCAGCTATGGGGTCAGAAGGGGCCGTGT
ATGCTTCGAGATGAAGATCAATGAGGAAATCTCCGTGAAGCACCTTCCGTCTACAGAGCCTGACCCCCAC
GTGGTCCGTATCGGCTGGTCCCTGGACTCCTGCAGCACCCAGCTAGGCGAAGAGCCTTTCTCCTATGGCT
ATGGAGGCACTGGGAAGAAGTCCACCAATAGCCGGTTTGAAAACTACGGAGACAAGTTTGCAGAGAACGA
TGTGATTGGCTGCTTTGCGGATTTTGAATGTGGAAATGACGTGGAACTGTCTTTTACCAAGAATGGAAAG
TGGATGGGCATTGCTTTCCGAATCCAGAAGGAAGCCTTGGGGGGTCAGGCCCTCTATCCTCATGTCCTGG
TGAAGAATTGCGCAGTGGAGTTCAACTTCGGACAGAGAGCAGAGCCCTACTGTTCTGTCCTCCCGGGGTT
TACCTTCATCCAGCACCTTCCCCTTAGTGAGCGTATCCGGGGCACCGTTGGACCAAAGAGCAAGGCAGAA
TGTGAGATTCTGATGATGGTGGGCCTGCCTGCTGCTGGCAAGACCACATGGGCCATCAAACATGCAGCCT
CCAACCCTTCCAAGAAGTACAACATCCTGGGTACCAATGCCATCATGGATAAGATGCGGGTGATGGGCCT
ACGCCGGCAGCGGAACTATGCTGGCCGCTGGGATGTCCTGATCCAGCAGGCCACCCAGTGCCTCAACCGC
CTCATCCAGATTGCTGCCCGCAAGAAACGCAACTATATCCTAGATCAGACAAATGTTTATGGGTCAGCCC
AGAGACGAAAAATGAGACCATTTGAAGGCTTCCAGCGCAAAGCTATTGTAATTTGTCCCACTGACGAGGA
CCTAAAAGACCGAACAATAAAGCGAACCGACGAGGAAGGGAAGGATGTCCCAGATCATGCGGTCTTAGAA
ATGAAAGCCAACTTCACGTTGCCAGATGTTGGGGACTTCCTGGATGAGGTTCTGTTCATTGAGCTGCAGC
GGGAGGAAGCGGACAAGCTAGTGAGGCAGTACAACGAGGAAGGCCGCAAGGCTGGGCCACCCCCTGAAAA
GCGCTTTGACAACCGAGGTGGTGGTGGCTTCCGGGGCCGCGGGGGTGGTGGTGGCTTCCAGCGCTATGAA
AACCGAGGACCCCCTGGAGGCAACCGTGGCGGCTTCCAGAACCGAGGGGGAGGCAGCGGTGGAGGAGGCA
ACTACCGAGGAGGTTTCAACCGCAGCGGAGGTGGTGGCTATAGCCAGAACCGCTGGGGTAACAACAACCG
GGATAACAACAACTCCAACAACAGAGGCAGCTACAACCGGGCTCCCCAGCAACAGCCGCCACCACAGCAG
CCTCCGCCACCACAGCCACCACCCCAGCAGCCACCGCCACCACCCAGCTACAGCCCTGCTCGGAACCCCC
CAGGGGCCAGCACCTACAATAAGAACAGCAACATCCCTGGCTCAAGCGCCAATACCAGCACCCCCACCGT
CAGCAGCTACAGCCCTCCACAGCCGAGTTACAGCCAGCCACCCTACAACCAGGGAGGTTACAGCCAGGGC
TACACAGCCCCACCGCCTCCACCTCCACCACCACCTGCCTACAACTATGGGAGCTACGGCGGTTACAACC
CGGCCCCCTATACCCCACCGCCACCCCCCACCGCACAGACCTACCCTCAGCCCAGCTATAACCAGTATCA
GCAGTATGCCCAGCAGTGGAACCAGTACTATCAGAACCAGGGCCAGTGGCCGCCATACTACGGGAACTAC
GACTACGGGAGCTACTCCGGGAACACACAGGGTGGCACAAGTACACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200576 protein sequence
Red=Cloning site Green=Tags(s)

MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHINEEVETEGGS
ELEGTAQPPPPGLQPHAEPGCYSGPDGHYAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPE
MKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTL
VAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPH
VVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGK
WMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAE
CEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNR
LIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLE
MKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYE
NRGPPGGNRGGFQNRGGGSGGGGNYRGGFNRSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQ
PPPPQPPPQQPPPPPSYSPARNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQG
YTAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY
DYGSYSGNTQGGTSTQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007040
ORF Size 2568 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007040.6
RefSeq Size 3892 bp
RefSeq ORF 2571 bp
Locus ID 11100
UniProt ID Q9BUJ2
Cytogenetics 19q13.2
Domains SAP, SPRY
Protein Families Druggable Genome
MW 95.8 kDa
Gene Summary This gene encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus early-1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by early-1B-55kDa in adenovirus-infected cells. [provided by RefSeq, Mar 2016]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.