HNRPUL1(HNRNPUL1) (NM_007040) Human Tagged ORF Clone

CAT#: RC200576

HNRNPUL1 (Myc-DDK-tagged)-Human heterogeneous nuclear ribonucleoprotein U-like 1 (HNRNPUL1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HNRPUL1(HNRNPUL1) (NM_007040) Human Tagged ORF Clone
Symbol HNRNPUL1
Synonyms E1B-AP5; E1BAP5; HNRPUL1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200576 representing NM_007040
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGTGCGCCGTCTGAAGGTGAACGAACTTCGCGAGGAGCTGCAGCGCCGCGGCCTGGACACTCGAG
GCCTCAAGGCCGAGCTTGCTGAGCGGCTGCAGGCGGCGTTGGAGGCCGAGGAGCCTGACGACGAGCGGGA
GCTCGACGCCGACGACGAACCGGGGCGACCCGGGCACATCAACGAGGAGGTCGAGACCGAGGGGGGCTCC
GAGCTGGAGGGGACCGCGCAGCCACCGCCGCCCGGGCTGCAGCCGCACGCGGAGCCCGGCTGCTACTCGG
GGCCGGACGGACATTATGCCATGGACAATATTACCAGGCAGAACCAATTCTACGATACCCAAGTCATCAA
ACAAGAAAACGAGTCAGGCTACGAGAGGAGACCACTGGAAATGGAGCAGCAGCAGGCCTATCGTCCAGAA
ATGAAGACAGAGATGAAGCAAGGAGCACCCACCAGCTTCCTCCCGCCTGAAGCTTCTCAACTCAAGCCAG
ACAGGCAGCAATTCCAGAGTCGAAAGAGGCCTTATGAAGAAAACCGGGGACGGGGGTACTTTGAGCACCG
AGAGGATAGGAGGGGCCGCTCTCCTCAGCCTCCTGCTGAAGAGGATGAAGATGACTTTGATGATACCCTT
GTTGCTATTGACACCTATAACTGCGACCTCCACTTCAAGGTGGCCCGAGATCGGAGTAGTGGCTATCCGC
TCACAATTGAGGGCTTTGCATACCTGTGGTCAGGAGCCCGTGCCAGCTATGGGGTCAGAAGGGGCCGTGT
ATGCTTCGAGATGAAGATCAATGAGGAAATCTCCGTGAAGCACCTTCCGTCTACAGAGCCTGACCCCCAC
GTGGTCCGTATCGGCTGGTCCCTGGACTCCTGCAGCACCCAGCTAGGCGAAGAGCCTTTCTCCTATGGCT
ATGGAGGCACTGGGAAGAAGTCCACCAATAGCCGGTTTGAAAACTACGGAGACAAGTTTGCAGAGAACGA
TGTGATTGGCTGCTTTGCGGATTTTGAATGTGGAAATGACGTGGAACTGTCTTTTACCAAGAATGGAAAG
TGGATGGGCATTGCTTTCCGAATCCAGAAGGAAGCCTTGGGGGGTCAGGCCCTCTATCCTCATGTCCTGG
TGAAGAATTGCGCAGTGGAGTTCAACTTCGGACAGAGAGCAGAGCCCTACTGTTCTGTCCTCCCGGGGTT
TACCTTCATCCAGCACCTTCCCCTTAGTGAGCGTATCCGGGGCACCGTTGGACCAAAGAGCAAGGCAGAA
TGTGAGATTCTGATGATGGTGGGCCTGCCTGCTGCTGGCAAGACCACATGGGCCATCAAACATGCAGCCT
CCAACCCTTCCAAGAAGTACAACATCCTGGGTACCAATGCCATCATGGATAAGATGCGGGTGATGGGCCT
ACGCCGGCAGCGGAACTATGCTGGCCGCTGGGATGTCCTGATCCAGCAGGCCACCCAGTGCCTCAACCGC
CTCATCCAGATTGCTGCCCGCAAGAAACGCAACTATATCCTAGATCAGACAAATGTTTATGGGTCAGCCC
AGAGACGAAAAATGAGACCATTTGAAGGCTTCCAGCGCAAAGCTATTGTAATTTGTCCCACTGACGAGGA
CCTAAAAGACCGAACAATAAAGCGAACCGACGAGGAAGGGAAGGATGTCCCAGATCATGCGGTCTTAGAA
ATGAAAGCCAACTTCACGTTGCCAGATGTTGGGGACTTCCTGGATGAGGTTCTGTTCATTGAGCTGCAGC
GGGAGGAAGCGGACAAGCTAGTGAGGCAGTACAACGAGGAAGGCCGCAAGGCTGGGCCACCCCCTGAAAA
GCGCTTTGACAACCGAGGTGGTGGTGGCTTCCGGGGCCGCGGGGGTGGTGGTGGCTTCCAGCGCTATGAA
AACCGAGGACCCCCTGGAGGCAACCGTGGCGGCTTCCAGAACCGAGGGGGAGGCAGCGGTGGAGGAGGCA
ACTACCGAGGAGGTTTCAACCGCAGCGGAGGTGGTGGCTATAGCCAGAACCGCTGGGGTAACAACAACCG
GGATAACAACAACTCCAACAACAGAGGCAGCTACAACCGGGCTCCCCAGCAACAGCCGCCACCACAGCAG
CCTCCGCCACCACAGCCACCACCCCAGCAGCCACCGCCACCACCCAGCTACAGCCCTGCTCGGAACCCCC
CAGGGGCCAGCACCTACAATAAGAACAGCAACATCCCTGGCTCAAGCGCCAATACCAGCACCCCCACCGT
CAGCAGCTACAGCCCTCCACAGCCGAGTTACAGCCAGCCACCCTACAACCAGGGAGGTTACAGCCAGGGC
TACACAGCCCCACCGCCTCCACCTCCACCACCACCTGCCTACAACTATGGGAGCTACGGCGGTTACAACC
CGGCCCCCTATACCCCACCGCCACCCCCCACCGCACAGACCTACCCTCAGCCCAGCTATAACCAGTATCA
GCAGTATGCCCAGCAGTGGAACCAGTACTATCAGAACCAGGGCCAGTGGCCGCCATACTACGGGAACTAC
GACTACGGGAGCTACTCCGGGAACACACAGGGTGGCACAAGTACACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200576 representing NM_007040
Red=Cloning site Green=Tags(s)

MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHINEEVETEGGS
ELEGTAQPPPPGLQPHAEPGCYSGPDGHYAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPE
MKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTL
VAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPH
VVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGK
WMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAE
CEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNR
LIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLE
MKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYE
NRGPPGGNRGGFQNRGGGSGGGGNYRGGFNRSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQ
PPPPQPPPQQPPPPPSYSPARNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQG
YTAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNY
DYGSYSGNTQGGTSTQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007040
ORF Size 2568 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007040.1, NM_007040.2, NM_007040.3, NM_007040.4, NM_007040.5, NP_008971
RefSeq Size 3872
RefSeq ORF 2571
Locus ID 11100
Cytogenetics 19q13.2
Domains SAP, SPRY
Protein Families Druggable Genome
MW 95.6 kDa
Gene Summary This gene encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus early-1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and its function is modulated by early-1B-55kDa in adenovirus-infected cells. [provided by RefSeq, Mar 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)