Syntaxin 4 (STX4) (NM_004604) Human Tagged ORF Clone

CAT#: RC200347

STX4 (Myc-DDK-tagged)-Human syntaxin 4 (STX4)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_004604" in other vectors (6)

Reconstitution Protocol

Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit polyclonal antibody to Syntaxin 4 (syntaxin 4)
    • 100 ul

USD 533.00

Other products for "Syntaxin 4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol Syntaxin 4
Synonyms p35-2; STX4A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200347 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGGACAGGACCCACGAGCTGAGACAGGGGGATGACAGCTCGGACGAAGAGGACAAGGAGCGGGTCG
CGCTGGTGGTGCACCCGGGCACGGCACGGCTGGGGAGCCCGGACGAGGAGTTCTTCCACAAGGTCCGGAC
AATTCGGCAGACTATTGTCAAACTGGGGAATAAAGTCCAGGAGTTGGAGAAACAGCAGGTCACCATCCTG
GCCACGCCCCTTCCCGAGGAGAGCATGAAGCAGGAGCTGCAGAACCTGCGCGATGAGATCAAACAGCTGG
GGAGGGAGATCCGCCTGCAGCTGAAGGCCATAGAGCCCCAGAAGGAGGAAGCTGATGAGAACTATAACTC
CGTCAACACAAGAATGAGAAAAACCCAGCATGGGGTCCTGTCCCAGCAATTCGTGGAGCTCATCAACAAG
TGCAATTCAATGCAGTCCGAATACCGGGAGAAGAACGTGGAGCGGATTCGGAGGCAGCTGAAGATCACCA
ATGCTGGGATGGTGTCTGATGAGGAGTTGGAGCAGATGCTGGACAGTGGGCAAAGCGAGGTGTTTGTGTC
CAATATCCTGAAGGACACGCAGGTGACTCGACAGGCCTTAAATGAGATCTCGGCCCGGCACAGTGAGATC
CAGCAGCTTGAACGCAGTATTCGTGAGCTGCACGACATATTCACTTTTCTGGCTACCGAAGTGGAGATGC
AGGGGGAGATGATCAATCGGATTGAGAAGAACATCCTGAGCTCAGCGGACTACGTGGAACGTGGGCAGGA
GCACGTCAAGACGGCCCTGGAGAACCAGAAGAAGGCGAGGAAGAAGAAAGTCTTGATTGCCATCTGTGTG
TCCATCACCGTCGTCCTCCTAGCAGTCATCATTGGCGTCACAGTGGTTGGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200347 protein sequence
Red=Cloning site Green=Tags(s)

MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTIL
ATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINK
CNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEI
QQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV
SITVVLLAVIIGVTVVG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004604
ORF Size 891 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004604.5
RefSeq Size 1494 bp
RefSeq ORF 894 bp
Locus ID 6810
UniProt ID Q12846
Cytogenetics 16p11.2
Domains t_SNARE, SynN
Protein Families Druggable Genome, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
MW 34.2 kDa
Gene Summary Plasma membrane t-SNARE that mediates docking of transport vesicles. Necessary for the translocation of SLC2A4 from intracellular vesicles to the plasma membrane. Together with STXB3 and VAMP2, may also play a role in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes (By similarity). May also play a role in docking of synaptic vesicles at presynaptic active zones.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.