HSPC152 (TRMT112) (NM_016404) Human Tagged ORF Clone

CAT#: RC200036

TRMT112 (Myc-DDK-tagged)-Human tRNA methyltransferase 11-2 homolog (S. cerevisiae) (TRMT112)

Product Images

Circular map for RC200036

• 

  Western blot validation of overexpression lysate (Cat# LY414001) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200036 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified TRMT112 protein (Cat# TP300036). The protein was produced from HEK293T cells transfected with TRMT112 cDNA clone (Cat# RC200036) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: HSPC152
• Synonyms: HSPC152; HSPC170; hTrm112; TRM112; TRMT11-2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200036 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAAACTGCTTACCCACAATCTGCTGAGCTCGCATGTGCGGGGGGTGGGGTCCCGTGGCTTCCCCCTGC
  GCCTCCAGGCCACCGAGGTCCGTATCTGCCCTGTGGAATTCAACCCCAACTTCGTGGCGCGTATGATACC
  TAAAGTGGAGTGGTCGGCGTTCCTGGAGGCGGCCGATAACTTGCGTCTGATCCAGGTGCCGAAAGGGCCG
  GTTGAGGGATATGAGGAGAATGAGGAGTTTCTGAGGACCATGCACCACCTGCTGCTGGAGGTGGAAGTGA
  TAGAGGGCACCCTGCAGTGCCCGGAATCTGGACGTATGTTCCCCATCAGCCGCGGGATCCCCAACATGCT
  GCTGAGTGAAGAGGAAACTGAGAGT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200036 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGP
  VEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_016404
• ORF Size: 375 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_016404.3
• RefSeq Size: 1305 bp
• RefSeq ORF: 378 bp
• Locus ID: 51504
• UniProt ID: Q9UI30
• Cytogenetics: 11q13.1
• Domains: DUF343
• MW: 14.2 kDa
• Gene Summary: Acts as an activator of both rRNA/tRNA and protein methyltransferases (PubMed:25851604). Together with methyltransferase BUD23, methylates the N(7) position of a guanine in 18S rRNA (PubMed:25851604). The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor (PubMed:18539146). The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species (PubMed:20308323). Involved in the pre-rRNA processing steps leading to small-subunit rRNA production (PubMed:25851604).[UniProtKB/Swiss-Prot Function]