Gapdhs (NM_001290631) Mouse Tagged ORF Clone

CAT#: MR229930

Gapdhs (myc-DDK-tagged) - Mouse glyceraldehyde-3-phosphate dehydrogenase, spermatogenic (Gapdhs), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 423.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Gapdhs (NM_001290631) Mouse Tagged ORF Clone
Symbol Gapdhs
Synonyms Gapd-s; Gapds
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR229930 representing NM_001290631
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGAGACGTGACGTGGTCCTTACCAATGTTACTGTTGTCCAGCTACGGCGGGACCGATGCCCATGCC
CATGCCCATGCCCATGTCCATGCCCATGCCCTGTGATCAGACCACCTCCACCCAAGGTTGAGGATCCACC
ACCCACGGTTGAAGAACAGCCACCGCCACCGCCGCCGCCACCTCCACCTCCACCACCACCTCCTCCTCCT
CCTCCACCCCAGATAGAGCCAGACAAGTTTGAAGAGGCTCCCCCTCCCCCTCCCCCTCCTCCTCCTCCTC
CCCCTCCCCCTCCCCCACCACTCCAAAAGCCAGCTAGAGAGCTGACAGTGGGTATCAATGGATTTGGACG
CATTGGTCGTCTGGTGCTGCGAGTCTGCATGGAGAAGGGCATTAGGGTGGTAGCAGTGAATGACCCATTC
ATTGATCCAGAATACATGGTTTACATGTTCAAATATGACTCCACACATGGTAGATACAAAGGAAACGTGG
AACATAAGAATGGACAACTAGTTGTGGACAACCTTGAGATCAACACGTACCAGTGCAAAGACCCTAAAGA
AATCCCCTGGAGCTCTATAGGGAATCCCTACGTGGTGGAGTGTACAGGCGTCTATCTGTCCATCGAGGCA
GCTTCGGCACATATTTCATCTGGTGCCAGGCGTGTGGTGGTCACTGCACCCTCCCCCGATGCACCCATGT
TTGTCATGGGAGTGAACGAGAAGGACTATAACCCTGGCTCTATGACCATTGTCAGCAATGCATCCTGTAC
CACCAACTGCCTGGCTCCTCTCGCCAAGGTTATTCATGAAAACTTCGGGATCGTGGAAGGGCTAATGACC
ACAGTCCATTCCTACACAGCCACTCAGAAGACAGTGGATGGGCCATCAAAGAAGGACTGGCGAGGTGGCC
GCGGCGCTCACCAAAACATCATCCCATCGTCCACTGGGGCTGCCAAGGCTGTAGGCAAAGTCATCCCAGA
GCTCAAAGGGAAGCTAACAGGAATGGCATTCCGGGTGCCAACCCCAAACGTGTCAGTTGTGGACCTGACC
TGCCGCCTGGCCAAGCCTGCTTCTTACTCGGCTATCACGGAGGCTGTGAAAGCTGCAGCCAAGGGACCTT
TGGCTGGCATCCTTGCTTACACAGAGGACCAGGTGGTCTCCACGGACTTTAACGGCAATCCCCATTCTTC
CATCTTTGATGCTAAGGCTGGAATTGCCCTCAATGACAACTTCGTGAAGCTTGTTGCCTGGTACGACAAC
GAATATGGCTACAGTAACCGAGTGGTCGACCTCCTCCGCTACATGTTTAGCCGAGAGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR229930 representing NM_001290631
Red=Cloning site Green=Tags(s)

MSRRDVVLTNVTVVQLRRDRCPCPCPCPCPCPCPVIRPPPPKVEDPPPTVEEQPPPPPPPPPPPPPPPPP
PPPQIEPDKFEEAPPPPPPPPPPPPPPPPPLQKPARELTVGINGFGRIGRLVLRVCMEKGIRVVAVNDPF
IDPEYMVYMFKYDSTHGRYKGNVEHKNGQLVVDNLEINTYQCKDPKEIPWSSIGNPYVVECTGVYLSIEA
ASAHISSGARRVVVTAPSPDAPMFVMGVNEKDYNPGSMTIVSNASCTTNCLAPLAKVIHENFGIVEGLMT
TVHSYTATQKTVDGPSKKDWRGGRGAHQNIIPSSTGAAKAVGKVIPELKGKLTGMAFRVPTPNVSVVDLT
CRLAKPASYSAITEAVKAAAKGPLAGILAYTEDQVVSTDFNGNPHSSIFDAKAGIALNDNFVKLVAWYDN
EYGYSNRVVDLLRYMFSREK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001290631
ORF Size 1320 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001290631.1, NP_001277560
RefSeq Size 1458
RefSeq ORF 1323
Locus ID 14447
Cytogenetics 7|7 B1
MW 48.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)