Bglap (NM_007541) Mouse Tagged ORF Clone
CAT#: MR226351
- TrueORF®
Bglap (Myc-DDK-tagged) - Mouse bone gamma carboxyglutamate protein (Bglap), transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"NM_007541" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Bglap |
Synonyms | Bgl; Bglap1; BGP; mOC; mOC-A; O; OC; OG; OG1; oste |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR226351 representing NM_007541
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGGACCATCTTTCTGCTCACTCTGCTGACCCTGGCTGCGCTCTGTCTCTCTGACCTCACAGATGCCA AGCCCAGCGGCCCTGAGTCTGACAAAGCCTTCATGTCCAAGCAGGAGGGCAATAAGGTAGTGAACAGACT CCGGCGCTACCTTGGAGCCTCAGTCCCCAGCCCAGATCCCCTGGAGCCCACCCGGGAGCAGTGTGAGCTT AACCCTGCTTGTGACGAGCTATCAGACCAGTATGGCTTGAAGACCGCCTACAAACGCATCTATGGTATCA CTATT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR226351 representing NM_007541
Red=Cloning site Green=Tags(s) MRTIFLLTLLTLAALCLSDLTDAKPSGPESDKAFMSKQEGNKVVNRLRRYLGASVPSPDPLEPTREQCEL NPACDELSDQYGLKTAYKRIYGITI myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_007541 |
ORF Size | 285 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_007541.3 |
RefSeq Size | 494 bp |
RefSeq ORF | 288 bp |
Locus ID | 12096 |
UniProt ID | P86546 |
Cytogenetics | 3 38.82 cM |
MW | 11 kDa |
Gene Summary | This gene encodes one of the most abundant non-collagenous proteins in bone tissue that is localized to the mineralized matrix of bone. The encoded preproprotein undergoes proteolytic processing and post-translational gamma carboxylation to generate a mature, calcium-binding protein. Mice lacking the encoded protein develop abnormalities of bone remodelling. This gene is located adjacent to two other osteocalcin-related genes on chromosome 3. [provided by RefSeq, Oct 2015] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC208188 | Bglap (untagged) - Mouse bone gamma carboxyglutamate protein (Bglap), transcript variant 1, (10ug) |
USD 225.00 |
|
MG226351 | Bglap (tGFP-tagged) - Mouse bone gamma carboxyglutamate protein (Bglap) transcript variant 1, (10ug) |
USD 425.00 |
|
MR226351L3 | Lenti ORF clone of Bglap (Myc-DDK-tagged) - Mouse bone gamma carboxyglutamate protein (Bglap), transcript variant 1 |
USD 525.00 |
|
MR226351L4 | Lenti ORF clone of Bglap (mGFP-tagged) - Mouse bone gamma carboxyglutamate protein (Bglap), transcript variant 1 |
USD 525.00 |
{0} Product Review(s)
Be the first one to submit a review