Il15ra (NM_133836) Mouse Tagged ORF Clone

CAT#: MR226273

Il15ra (Myc-DDK-tagged) - Mouse interleukin 15 receptor, alpha chain (Il15ra), transcript variant 2

Product Images

Circular map for MR226273

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Il15ra
• Synonyms: AA690181; IL-15RA
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR226273 representing NM_133836
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACCACAGAGACAGCTATTATGCCTGGCTCCAGGCTGACACCATCCCAAACAACTTCTGCAGGAACTA
  CAGGGACAGGCAGTCACAAGTCCTCCCGAGCCCCATCTCTTGCAGCAACAATGACCTTGGAGCCTACAGC
  CTCCACCTCCCTCAGGATAACAGAGATTTCTCCCCACAGTTCCAAAATGACGAAAGTGGCCATCTCTACA
  TCGGTCCTCTTGGTTGGTGCAGGGGTTGTGATGGCTTTCCTGGCCTGGTACATCAAATCAAGGCAGCCTT
  CTCAGCCGTGCCGTGTTGAGGTGGAAACCATGGAAACAGTACCAATGACTGTGAGGGCCAGCAGCAAGGA
  GGATGAAGACACAGGAGCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR226273 representing NM_133836
  Red=Cloning site Green=Tags(s)
  
  MTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTKVAIST
  SVLLVGAGVVMAFLAWYIKSRQPSQPCRVEVETMETVPMTVRASSKEDEDTGA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_133836
• ORF Size: 369 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_133836.2, NP_598597.1
• RefSeq Size: 1465 bp
• RefSeq ORF: 372 bp
• Locus ID: 16169
• UniProt ID: Q60819
• Cytogenetics: 2 8.97 cM
• MW: 13.4 kDa
• Gene Summary: High-affinity receptor for interleukin-15 (PubMed:17947230). Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells (PubMed:17947230). In neutrophils, binds and activates kinase SYK in response to IL15 stimulation (By similarity). In neutrophils, required for IL15-induced phagocytosis in a SYK-dependent manner (By similarity).[UniProtKB/Swiss-Prot Function]