Ccr2 (NM_009915) Mouse Tagged ORF Clone

CAT#: MR225805

  • TrueORF®

Ccr2 (Myc-DDK-tagged) - Mouse chemokine (C-C motif) receptor 2 (Ccr2)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_009915" in other vectors (6)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Ccr2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Ccr2
Synonyms Cc-ckr-2; Ccr2a; Ccr2b; Ckr2; Ckr2a; Ckr2b; Cmkbr2; mJe-r
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR225805 representing NM_009915
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGACAATAATATGTTACCTCAGTTCATCCACGGCATACTATCAACATCTCATTCTCTATTTACAC
GAAGTATCCAAGAGCTTGATGAAGGGGCCACCACACCGTATGACTACGATGATGGTGAGCCTTGTCATAA
AACCAGTGTGAAGCAAATTGGAGCTTGGATCCTGCCTCCACTCTACTCCCTGGTATTCATCTTTGGTTTT
GTGGGCAACATGTTGGTCATTATAATTCTGATAGGCTGTAAAAAGCTGAAGAGCATGACTGATATCTATC
TGCTCAACTTGGCCATCTCTGACCTGCTCTTCCTGCTCACATTACCATTCTGGGCTCACTATGCTGCAAA
TGAGTGGGTCTTTGGGAATATAATGTGTAAAGTATTCACAGGGCTCTATCACATTGGTTATTTTGGTGGA
ATCTTTTTCATTATCCTCCTGACAATTGATAGGTACTTGGCTATTGTTCATGCTGTGTTTGCTTTAAAAG
CCAGGACAGTTACCTTTGGGGTGATAACAAGTGTAGTCACTTGGGTGGTGGCTGTGTTTGCCTCTCTACC
AGGAATCATATTTACTAAATCCAAACAAGATGATCACCATTACACCTGTGGCCCTTATTTTACACAACTA
TGGAAGAATTTCCAAACAATAATGAGAAATATCTTGAGCCTGATCCTGCCTCTACTTGTCATGGTCATCT
GCTACTCAGGAATTCTCCACACCCTGTTTCGCTGTAGGAATGAGAAGAAGAGGCACAGGGCTGTGAGGCT
CATCTTTGCCATCATGATTGTCTACTTTCTCTTCTGGACTCCATACAATATTGTTCTCTTCTTGACCACC
TTCCAGGAATCCTTGGGAATGAGTAACTGTGTGATTGACAAGCACTTAGACCAGGCCATGCAGGTGACAG
AGACTCTTGGAATGACACACTGCTGCATTAATCCTGTCATTTATGCCTTTGTTGGAGAGAAGTTCCGAAG
GTATCTCTCCATATTTTTCAGAAAGCACATTGCTAAACGTCTCTGCAAACAGTGCCCAGTTTTCTATAGG
GAGACAGCAGATCGAGTGAGCTCTACATTCACTCCTTCCACTGGGGAGCAAGAGGTCTCGGTTGGGTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR225805 representing NM_009915
Red=Cloning site Green=Tags(s)

MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGAWILPPLYSLVFIFGF
VGNMLVIIILIGCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGG
IFFIILLTIDRYLAIVHAVFALKARTVTFGVITSVVTWVVAVFASLPGIIFTKSKQDDHHYTCGPYFTQL
WKNFQTIMRNILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLFLTT
FQESLGMSNCVIDKHLDQAMQVTETLGMTHCCINPVIYAFVGEKFRRYLSIFFRKHIAKRLCKQCPVFYR
ETADRVSSTFTPSTGEQEVSVGL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_009915
ORF Size 1119 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_009915.2, NP_034045.1
RefSeq Size 3589 bp
RefSeq ORF 1122 bp
Locus ID 12772
UniProt ID P51683
Cytogenetics 9 75.05 cM
MW 43.2 kDa
Gene Summary Key functional receptor for CCL2 but can also bind CCL7 and CCL12 chemokines (PubMed:8631787, PubMed:8662823, PubMed:8996246). Its binding with CCL2 on monocytes and macrophages mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion (By similarity). Also acts as a receptor for the beta-defensin DEFB106A/DEFB106B (By similarity). Regulates the expression of T-cell inflammatory cytokines and T-cell differentiation, promoting the differentiation of T-cells into T-helper 17 cells (Th17) during inflammation (PubMed:28507030). Faciltates the export of mature thymocytes by enhancing directional movement of thymocytes to sphingosine-1-phosphate stimulation and up-regulation of S1P1R expression; signals through the JAK-STAT pathway to regulate FOXO1 activity leading to an increased expression of S1P1R (PubMed:29930553). Plays an important role in mediating peripheral nerve injury-induced neuropathic pain (PubMed:29993042). Increases NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, which may be caused by MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B (PubMed:29993042). Mediates the recruitment of macrophages and monocytes to the injury site following brain injury (PubMed:24806994, PubMed:29632244).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.