Smarcb1 (NM_001161853) Mouse Tagged ORF Clone

CAT#: MR225556

  • TrueORF®

Smarcb1 (Myc-DDK-tagged) - Mouse SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 (Smarcb1), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001161853" in other vectors (3)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 686.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Smarcb1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Smarcb1
Synonyms AU020204; Baf47; Ini1; Snf5; SNF5/INI1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR225556 representing NM_001161853
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGATGATGGCGTTGAGCAAGACCTTCGGGCAGAAGCCCGTCAAGTTTCAGCTGGAGGACGACGGGG
AGTTCTACATGATCGGCTCCGAGGTGGGAAACTACCTGCGTATGTTCCGAGGTTCTCTGTACAAGAGATA
CCCCTCACTCTGGCGGCGACTAGCCACTGTGGAAGAAAGGAAGAAAATAGTGGCATCGTCACATGATCAT
GGATATACCACCCTGGCCACCAGCGTGACACTCCTGAAAGCCTCAGAGGTAGAAGAGATCCTGGATGGCA
ATGACGAGAAGTACAAGGCTGTGTCCATCAGCACAGAGCCCCCGACCTACCTCAGGGAGCAGAAGGCCAA
GAGGAACAGCCAGTGGGTCCCCACCCTGCCCAACAGCTCCCACCACCTGGATGCTGTGCCCTGTTCCACC
ACCATCAACAGGAACCGCATGGGTCGGGACAAGAAGAGAACCTTCCCCTTGTGCTTTGATGACCACGACC
CAGCTGTGATCCATGAGAATGCGTCACAGCCTGAGGTGCTGGTGCCCATCCGGCTCGACATGGAGATCGA
CGGGCAGAAGCTGCGAGACGCTTTTACCTGGAACATGAATGAGAAGCTAATGACTCCTGAGATGTTTTCA
GAAATACTTTGTGATGACCTGGATTTGAATCCACTGACTTTTGTGCCAGCTATTGCCTCTGCCATTCGAC
AGCAGATTGAGTCCTACCCCACAGACAGCATCCTAGAGGATCAATCCGACCAGCGTGTCATCATCAAGCT
GAACATCCACGTGGGGAACATCTCCCTGGTGGACCAGTTTGAGTGGGACATGTCAGAGAAAGAGAACTCC
CCAGAGAAGTTTGCCCTGAAGCTGTGCTCAGAGCTGGGCTTGGGCGGGGAGTTTGTCACCACCATTGCAT
ACAGCATCCGAGGACAGCTGAGCTGGCACCAGAAGACCTATGCCTTCAGTGAGAACCCACTTCCCACAGT
GGAGATTGCCATCCGAAATACCGGAGATGCTGACCAGTGGTGCCCCCTGCTGGAGACACTGACTGATGCC
GAGATGGAGAAAAAGATCCGGGATCAAGATAGGAACACAAGGCGAATGAGGCGTCTTGCCAACACTGCCC
CAGCCTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR225556 representing NM_001161853
Red=Cloning site Green=Tags(s)

MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHDH
GYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCST
TINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFS
EILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENS
PEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDA
EMEKKIRDQDRNTRRMRRLANTAPAW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001161853
ORF Size 1131 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001161853.1, NP_001155325.1
RefSeq Size 1647 bp
RefSeq ORF 1131 bp
Locus ID 20587
Cytogenetics 10 C1
MW 43.2 kDa
Gene Summary Core component of the BAF (SWI/SNF) complex. This ATP-dependent chromatin-remodeling complex plays important roles in cell proliferation and differentiation, in cellular antiviral activities and inhibition of tumor formation. The BAF complex is able to create a stable, altered form of chromatin that constrains fewer negative supercoils than normal. This change in supercoiling would be due to the conversion of up to one-half of the nucleosomes on polynucleosomal arrays into asymmetric structures, termed altosomes, each composed of 2 histones octamers. Stimulates in vitro the remodeling activity of SMARCA4/BRG1/BAF190A. Plays a key role in cell-cycle control and causes cell cycle arrest in G0/G1. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.