Cldn1 (NM_016674) Mouse Tagged ORF Clone

CAT#: MR225404

Cldn1 (Myc-DDK-tagged) - Mouse claudin 1 (Cldn1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 259.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cldn1 (NM_016674) Mouse Tagged ORF Clone
Symbol Cldn1
Synonyms AI596271
Vector pCMV6-Entry
Sequence Data
>MR225404 representing NM_016674
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAACGCGGGGCTGCAGCTGCTGGGTTTCATCCTGGCTTCTCTGGGATGGATCGGCTCCATCGTCA
GCACTGCCCTGCCCCAGTGGAAGATTTACTCCTATGCTGGGGACAACATCGTGACCGCTCAGGCCATCTA
CGAGGGACTGTGGATGTCCTGCGTTTCGCAAAGCACCGGGCAGATACAGTGCAAAGTCTTCGATTCCTTG
CTGAATCTGAACAGTACTTTGCAGGCAACCCGAGCCTTGATGGTAATTGGCATCCTGCTGGGGCTGATCG
CAATCTTTGTGTCCACCATTGGCATGAAGTGCATGAGGTGCCTGGAAGATGATGAGGTGCAGAAGATGTG
GATGGCTGTCATTGGGGGCATAATATTTTTAATTTCAGGTCTGGCGACATTAGTGGCCACAGCATGGTAT
GGAAACAGAATTGTTCAAGAATTCTATGACCCCTTGACCCCCATCAATGCCAGGTATGAATTTGGCCAGG
CCCTCTTTACTGGCTGGGCCGCTGCCTCCCTCTGCCTTCTGGGAGGTGTCCTACTTTCCTGCTCCTGTCC
CCGGAAAACAACCTCTTACCCAACACCACGGCCTTATCCCAAGCCAACACCTTCTAGTGGGAAAGACTAT
GTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR225404 representing NM_016674
Red=Cloning site Green=Tags(s)

MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSL
LNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAVIGGIIFLISGLATLVATAWY
GNRIVQEFYDPLTPINARYEFGQALFTGWAAASLCLLGGVLLSCSCPRKTTSYPTPRPYPKPTPSSGKDY
V

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016674
ORF Size 633 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016674.1, NM_016674.2, NM_016674.3, NM_016674.4, NP_057883
RefSeq Size 3263
RefSeq ORF 636
Locus ID 12737
Cytogenetics 16|16 B2
MW 23.3 kDa
Gene Summary This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The knockout mice lacking this gene die soon after birth as a consequence of dehydration from trandermal water loss, indicating that this gene is indispensable for creating and maintaining the epidermal barrier. The protein encoded by this gene also has gastric tumor suppressive activity, and is a key factor for hepatitis C virus (HCV) entry. [provided by RefSeq, Aug 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)