Batf3 (NM_030060) Mouse Tagged ORF Clone

CAT#: MR224969

Batf3 (Myc-DDK-tagged) - Mouse basic leucine zipper transcription factor, ATF-like 3 (Batf3)

Product Images

Circular map for MR224969

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Batf3
• Synonyms: 9130211I03Rik; Snft
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR224969 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCGCAAGGGCCCCCCGCGGTCAGCGTGCTGCAGAGAAGCGTGGATGCGCCCGGGAACCAGCCGCAGA
  GCCCCAAGGACGATGACAGGAAAGTTCGAAGGAGAGAGAAAAACCGGGTTGCAGCTCAGAGGAGCCGGAA
  GAAGCAGACCCAGAAGGCTGACAAGCTCCACGAGGAGCACGAGAGCCTGGAGCAGGAGAACTCTGTGCTG
  CGCAGGGAGATTTCGAAGCTGAAGGAGGAGCTGCGTCACCTGAGCGAGGTGCTGAAGGAGCACGAGAAGA
  TGTGCCCGCTGCTGCTGTGTCCTATGAACTTTGTGCAGCTTCGGTCAGACCCCGTGGCCAGCTGTCTACC
  ACGA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR224969 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSQGPPAVSVLQRSVDAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEHESLEQENSVL
  RREISKLKEELRHLSEVLKEHEKMCPLLLCPMNFVQLRSDPVASCLPR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_030060
• ORF Size: 357 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_030060.2, NP_084336.1
• RefSeq Size: 712 bp
• RefSeq ORF: 357 bp
• Locus ID: 381319
• UniProt ID: Q9D275
• Cytogenetics: 1 H6
• MW: 13.7 kDa
• Gene Summary: AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens.[UniProtKB/Swiss-Prot Function]