Malt1 (NM_172833) Mouse Tagged ORF Clone

CAT#: MR224110

Reviews ()
Write a review
  • TrueORF®

Malt1 (Myc-DDK-tagged) - Mouse mucosa associated lymphoid tissue lymphoma translocation gene 1 (Malt1)

  View "NM_172833" in other vectors (6)

Interest in protein/lysate? Sumbit request here!

USD 68.00

USD 639.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Malt1 (NM_172833) Mouse Tagged ORF Clone
Symbol Malt1
Synonyms A630046N12; D430033E09Rik; Pcasp1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR224110 representing NM_172833
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCTGTGGGGGCAGCCGCTGCAGGCCTCACCTCCCCTGGCCGTGCGGCAGCCCCCTACCGCGTCCT
CGGGACCTTCGACCTCCCCTCCAGCCGGCGCAACCCTCAACCGCCTGCCCGAGCCGCTGCTGCGGAGGCT
CAGCGAGAGCTTGGACCGCGCTCCGGAGGGCCGGGGCTGGCGGCAGCTGGCCGAGCTGGCGGGCAGTCGG
GGACGCCTCCGGCTCAGTGGCCTGGACCTGGAACAGTGTTCTCTTAAAGTATTGGAGCCAGAGGGAAGCC
CAAGTTTGTGTTTATTGAAACTAATGGGTGAAAAAGGATGTACAGTCACAGAACTGAGCGACTTCCTACA
GGCTTTGGAGCACACTGAGGTTCTTCCGCTTCTCAACCCCCCAGGATTAAAGATCACTGTAAACCCAGAA
TCCAAGGCAGTGTTGGCTGGACAGTTTGTAAAACTGTGCTGCCGGGCAACTGGACATCCTTTTGTACAAT
ATCAATGGTTCAAAATGAATAAAGAGATCCCATATGGAAATTCATCAGAACTTGTTTTTAACACAGTGCA
TGTAAAAGATGCAGGCTTTTATGTCTGCCGGGTTAACAACAGTTCCACTTTTGAATTTAGCCAGTGGTCA
CAGCTGGATGTGTGTGATGTGGCAGAAGTAACAGACAGCTTCCAGGGAAGTATGGATGGCATCTCAGAAT
CCAGGTTGCAAATCTGTGTTGAACCAAGGTCCCAAAGGCTGGTGCCAGGCAGCATGTTGTTGTTACAGTG
TGTTGCTATTGGAAGTCCTATGCCTCACTACCAGTGGTTTAAAGATGAATCACCATTAACACATGAGACA
AAAAAGCACTACACGGTTCCATATGTGGATATAGAACATGAAGGAACCTACTGGTGTCATGTATATAATG
ACCGAGACAGTCAAGATAGCAAGAAGGCAGAAGTCACCATAGATGAATTAAACAATTTGGGGCATCCTGA
TAATAAAGAACAAACTGGCCAGCCTTTGGCAAAGGACAAAGTCGCCCTTTTGATAGGGAATATGAGTTAC
TGGGAGCATCCCAAGCTTAAAGCGCCTTTGGTGGATGTGTATGAATTGACCAACTTACTAAGACAACTAG
ATTTCAAAGTTGTCTCACTGTTGGACCTTACTGAATATGAGATGTGTAACGCTGTGGATGAATTTTTACT
ACTTTTAGACAAAGGAGTATATGGATTGTTATATTATGCAGGGCACGGTTATGAAAACTTTGGAAACAGT
TTCATGGTCCCTGTTGATGCTCCAAATCCATATAGGTCTGAAAATTGCCTATGCGTACAAAACATACTGA
AATTAATGCAAGAAAAGGAGACTGGCCTGAATGTGTTCCTGTTGGATATGTGTCGGAAAAGAAATGACTA
CGATGATACCATTCCAATCTTGGACGCACTGAAAGTCACTGCCAACATTGTGTTTGGATATGCCACGTGC
CAAGGAGCAGAAGCCTTTGAAATCCAGCATTCTGGGTTGGCAAATGGGATTTTTATGAAATTTTTAAAAG
ATAGATTATTAGAAGACAAGAAAATTACTGTGTTACTGGATGAAGTTGCAGAAGATATGGGTAAATGTCA
CCTTACCAAAGGCAGACAAGCTCTAGAGATTCGCAGCAGCTTGTCTGAAAAGAGAGCACTTACTGATCCA
GTCCAGGGAGCACCTTGCTCTGCAGAGGCTCTGGTGCGCAATCTACAGTGGGCCAAGGCTCATGAACTTC
CAGAAAGTATGTGCCTTAAATTTCAGTGTGGCGTTCACATTCAATTAGGATTTGCCGCAGAGTTCTCCAA
TGTCATGATAATCTACACAAGTATAGTCCACAAACCACCTGAGATAATAATGTGTGACGCCTATGTTACT
GATTTCCCTCTTGACCTAGATATTGATCCAAAACATGCAAACAAGGGGACTCCTGAAGAAACTGGCAGCT
ACTTAGTATCAAAAGACCTTCCCAAGCACTGCCTCTACACTAGACTCAGCTCACTACAAAAATTAAAGGA
ACATCTGATCTTCACAGTCTGTCTGTCCTATCAGTATTCAGGACTAGAAGACACTGTGGAGGAGAAGCAG
GAGGTGAACGTGGGGAAGCCTCTTATTGCCAAGCTAGACATGCACCGAGGACTGGGCAGGAAGACTTGCT
TCCAAGCTTGTCGTATGCCTGACGAGCCGTACCACAGCTCCACATCTACCTCAGCGGGAGCGGGGCATTT
CCATTCCTCTCAGGACTCATTCCATGATGTGTACCATTCACATCTTGGCAATGCAGACAGTGGTATGCCA
CCAGACAGGTGTCATTGCAGCCGGACTCCACACACATTCATTTCAAATTATCCCCCCCACCACTACTGCC
AGTTTGGTAGAAGTAATGTGCCCGTAGAGACAACTGATGAAATGCCATTCAGTTTTTCTGACAGGCTTAT
GATTTCTGAAAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR224110 representing NM_172833
Red=Cloning site Green=Tags(s)

MSLWGQPLQASPPLAVRQPPTASSGPSTSPPAGATLNRLPEPLLRRLSESLDRAPEGRGWRQLAELAGSR
GRLRLSGLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQALEHTEVLPLLNPPGLKITVNPE
SKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPYGNSSELVFNTVHVKDAGFYVCRVNNSSTFEFSQWS
QLDVCDVAEVTDSFQGSMDGISESRLQICVEPRSQRLVPGSMLLLQCVAIGSPMPHYQWFKDESPLTHET
KKHYTVPYVDIEHEGTYWCHVYNDRDSQDSKKAEVTIDELNNLGHPDNKEQTGQPLAKDKVALLIGNMSY
WEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNS
FMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATC
QGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGRQALEIRSSLSEKRALTDP
VQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVT
DFPLDLDIDPKHANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQ
EVNVGKPLIAKLDMHRGLGRKTCFQACRMPDEPYHSSTSTSAGAGHFHSSQDSFHDVYHSHLGNADSGMP
PDRCHCSRTPHTFISNYPPHHYCQFGRSNVPVETTDEMPFSFSDRLMISEN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_172833
ORF Size 2463 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_172833.1, NM_172833.2, NP_766421
RefSeq Size 5008
RefSeq ORF 2466
Locus ID 240354
Cytogenetics 18 E1
MW 92.5 kDa

Other Versions

Other products for "Malt1"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Order online and get additional $20 off!
40% off proteins and antibodies
68 Mouse Clones