Hspa1l (NM_013558) Mouse Tagged ORF Clone

CAT#: MR223206

Hspa1l (Myc-DDK-tagged) - Mouse heat shock protein 1-like (Hspa1l)

Change vector?

  • TrueORF®

USD 98

USD 790


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Hspa1l (NM_013558) Mouse Tagged ORF Clone
Symbol Hspa1l
Synonyms Hsc70t; Msh5
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR223206 representing NM_013558
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCTAATAAAGGAATGGCGATCGGCATCGACTTGGGCACCACCTACTCGTGCGTGGGCGTGTTCC
AGCACGGCAAGGTGGAGATCATCGCCAACGACCAGGGCAACCGCACGACCCCTAGCTACGTGGCCTTCAC
CGACACCGAGCGCCTCATCGGAGACGCTGCCAAGAACCAGGTGGCCATGAATCCCCAGAACACTGTTTTT
GATGCCAAACGTCTAATTGGCAGGAAGTTTAATGATCCTGTTGTGCAGTCAGATATGAAGCTTTGGCCAT
TTCAAGTGATCAATGAAGCCGGCAAACCCAAGGTGATGGTGTCCTATAAAGGAGAGAAGAAAGCCTTCTA
CCCAGAGGAGATCTCATCCATGGTACTGACGAAGATGAAGGAGACTGCAGAGGCTTTTTTGGGCCACAAT
GTCACCAACGCTGTGATCACGGTGCCAGCCTATTTCAATGACTCTCAGCGGCAAGCCACCAAGGATGCAG
GTGTCATCGCAGGACTCAATGTGCTGAGAATAATCAATGAGCCCACGGCGGCCGCCATCGCCTACGGCTT
GGATAAAGGAAGTCACGGAGAGCGGCACGTGCTCATCTTCGACCTGGGGGGTGGCACGTTCGACGTGTCC
ATCCTGACGATCGACGACGGCATCTTCGAGGTGAAGGCCACGGCGGGCGACACGCACCTGGGAGGGGAGG
ACTTCGACAACCGGCTGGTGAGCCACTTCGTGGAGGAGTTCAAGAGGAAGCACAAGAAGGACATCAGCCA
GAACAAGCGCGCGGTGCGGCGGCTGCGCACTGCGTGTGAGAGGGCCAAGAGGACGCTGTCGTCCAGCACC
CAGGCAAACCTGGAGATCGACTCTTTATATGAGGGCATCGACTTCTACACGTCCATCACTAGAGCACGGT
TTGAAGAGCTGTGTGCAGACCTATTTAGAGGCACACTTGAGCCCGTGGAAAAGTCTCTTCGGGATGCCAA
GATGGATAAGGCTAAAATCCATGACATTGTTCTAGTAGGGGGCTCCACCCGCATCCCAAAGGTGCAAAAA
CTGCTTCAGGACTACTTTAATGGACGGGATCTCAACAAGAGTATCAATCCCGATGAGGCAGTCGCCTACG
GAGCTGCAGTCCAGGCAGCTATTTTAATGGGCGACAAATCTGAAAAAGTACAGGATTTGCTTTTGTTGGA
CGTAGCTCCCCTGTCTCTAGGATTGGAGACAGCTGGGGGTGTGATGACTGTACTGATCAAGCGCAACTCC
ACCATCCCCACCAAGCAGACGCAGATCTTCACCACCTACTCGGACAACCAGCCCGGGGTGCTGATCCAGG
TGTACGAGGGCGAGAGAGCCATGACGCGCGACAACAACCTGCTGGGGCGCTTTGACTTGACTGGAATACC
TCCTGCACCTAGGGGCGTGCCACAGATCGAGGTGACCTTCGACATCGACGCCAACGGTATCCTGAACGTC
ACGGCCATGGACAAGAGCACCGGCAAGGCCAACAAGATCACCATCACCAACGACAAGGGTCGCCTGAGCA
AGGAGGAGATTGAGCGCATGGTGCAGGAGGCCGAGCGCTACAAAGCGGAGGATGAGGGCCAGAGGGAGAA
AATCGCTGCCAAAAATGCCTTAGAATCGTACGCCTTTAATATGAAGAGCGCTGTGGGTGATGAGGGTCTG
AAGGACAAGATCAGCGAGTCCGATAAAAAGAAAATACTGGATAAATGCAATGAGGTCCTTTCCTGGCTGG
AGGCCAACCAGCTGGCTGAGAAAGATGAGTTTGATCATAAAAGAAAAGAACTGGAAAATATGTGTAATCC
GATCATCACAAAACTGTACCAGAGCGGATGCACCGGGCCCACCTGTACGCCAGGGTATACTCCCGGCAGG
GCTGCCACAGGCCCTACCATCGAGGAAGTAGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR223206 representing NM_013558
Red=Cloning site Green=Tags(s)

MAANKGMAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVF
DAKRLIGRKFNDPVVQSDMKLWPFQVINEAGKPKVMVSYKGEKKAFYPEEISSMVLTKMKETAEAFLGHN
VTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGSHGERHVLIFDLGGGTFDVS
ILTIDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSST
QANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKSLRDAKMDKAKIHDIVLVGGSTRIPKVQK
LLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTVLIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTRDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNV
TAMDKSTGKANKITITNDKGRLSKEEIERMVQEAERYKAEDEGQREKIAAKNALESYAFNMKSAVGDEGL
KDKISESDKKKILDKCNEVLSWLEANQLAEKDEFDHKRKELENMCNPIITKLYQSGCTGPTCTPGYTPGR
AATGPTIEEVD

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_013558
ORF Size 1923 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013558.1, NM_013558.2, NP_038586
RefSeq Size 2415
RefSeq ORF 1926
Locus ID 15482
Cytogenetics 17 B1|17 18.51 cM
MW 71.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations