Dusp13 (NM_013849) Mouse Tagged ORF Clone

CAT#: MR218320

Dusp13 (Myc-DDK-tagged) - Mouse dual specificity phosphatase 13 (Dusp13), transcript variant 2

Product Images

Circular map for MR218320

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Dusp13
• Synonyms: DUSP13A; DUSP13B; Gm1203; LMW-D; LMW-DSP6; MDSP; TMD; TMDP; TS-D; TS-DSP6
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR218320 representing NM_013849
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCAGGCTGGGCAGAGACCACTGCAGTCTGCCCTTGGCATTTACCTGCCAAAGTCTCTTTCCCAGACAC
  CTCGATGTCCTTCTGTGAGAACGCTAGCCCCACTTGGTCTGTGCTCCCTAAGAGAAGAGGGGAGACAGAG
  AGGGAACAGCAGAGGAGACCAGGAGAAATGTGTTCTGAGGTTACAGCTAAAGAGAATGGACTCGCTACAG
  AAGCAGGAACTTCGGAGGCCAAAGATTCATGGGGCAGTCCAGGTGTCCCCCTACCAGCCACCCACACTGG
  CCTCTCTGCAGCGATTGCTGTGGGTCCGTCGGACTGCCACACTGACCCACATCAATGAGGTCTGGCCCAA
  CCTTTTCTTGGGAGATGCGTATGCTGCCAGAGACAAGGGTCGTCTAATCCAGCTGGGCATTACCCATGTT
  GTGAATGTGGCTGCGGGCAAGTTCCAGGTGGACACAGGTGCCAAGTTCTACCGTGGAACACCTCTGGAGT
  ACTATGGCATTGAGGCTGATGACAACCCCTTCTTTGACCTCAGCGTCCACTTTCTGCCTGTTGCTCGTTA
  CATCAGAGATGCCCTCAATATTCCCCGAAGCCGAGTGCTGGTCCACTGCGCTATGGGGGTGAGTCGCTCT
  GCCACAATTGTCTTGGCCTTCCTCATGATCTTCGAGAACATGACACTGGTAGATGCCATCCAGACGGTGC
  AGGCCCACCGAGATATCTGTCCCAACTCAGGCTTCCTCCGACAGCTCCAGGTTCTGGACAACAGGCTGAG
  GCGGGAAACAGGAAGACTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR218320 representing NM_013849
  Red=Cloning site Green=Tags(s)
  
  MQAGQRPLQSALGIYLPKSLSQTPRCPSVRTLAPLGLCSLREEGRQRGNSRGDQEKCVLRLQLKRMDSLQ
  KQELRRPKIHGAVQVSPYQPPTLASLQRLLWVRRTATLTHINEVWPNLFLGDAYAARDKGRLIQLGITHV
  VNVAAGKFQVDTGAKFYRGTPLEYYGIEADDNPFFDLSVHFLPVARYIRDALNIPRSRVLVHCAMGVSRS
  ATIVLAFLMIFENMTLVDAIQTVQAHRDICPNSGFLRQLQVLDNRLRRETGRL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_013849
• ORF Size: 789 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_013849.3, NP_038877.2
• RefSeq Size: 1071 bp
• RefSeq ORF: 792 bp
• Locus ID: 27389
• UniProt ID: Q9QYJ7
• Cytogenetics: 14 A3
• MW: 29.7 kDa
• Gene Summary: Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In humans, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008]