Hist1h1e (NM_015787) Mouse Tagged ORF Clone

CAT#: MR216630

Hist1h1e (Myc-DDK-tagged) - Mouse histone cluster 1, H1e (Hist1h1e)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 149.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Hist1h1e (NM_015787) Mouse Tagged ORF Clone
Symbol Hist1h1e
Synonyms H1-4; H1.4; H1e; H1f4; H1s-4; H1var2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR216630 representing NM_015787
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGAGACCGCGCCTGCTGCGCCCGCCGCACCGGCCCCCGCCGAGAAGACACCCGTCAAGAAGAAGG
CCCGCAAGGCCGCAGGTGGCGCGAAGCGCAAAACCTCCGGACCCCCGGTGTCCGAACTCATCACCAAGGC
TGTGGCCGCCTCCAAGGAGCGCAGCGGCGTGTCCCTGGCTGCGCTCAAGAAGGCGCTGGCGGCCGCGGGG
TACGATGTGGAGAAGAACAACAGCCGCATCAAGCTCGGCCTGAAGAGCCTGGTGAGCAAGGGTACCCTGG
TGCAGACCAAGGGCACCGGCGCCTCCGGCTCCTTCAAACTCAACAAGAAGGCGGCTTCCGGTGAGGCTAA
GCCCAAAGCAAAAAGGGCAGGCGCGGCCAAGGCGAAGAAGCCTGCGGGCGCAGCCAAGAAGCCCAAGAAG
GCTGCGGGGACAGCCACCGCCAAGAAGAGCACCAAGAAGACTCCAAAGAAAGCGAAGAAGCCAGCTGCAG
CTGCAGGAGCCAAAAAAGCTAAGAGCCCGAAGAAGGCAAAGGCAACTAAGGCTAAGAAGGCGCCCAAGAG
CCCTGCCAAGGCGAAAACGGTAAAGCCTAAAGCGGCCAAACCAAAAACCTCCAAGCCTAAGGCAGCTAAG
CCAAAGAAAACCGCAGCCAAGAAAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR216630 representing NM_015787
Red=Cloning site Green=Tags(s)

MSETAPAAPAAPAPAEKTPVKKKARKAAGGAKRKTSGPPVSELITKAVAASKERSGVSLAALKKALAAAG
YDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKAKRAGAAKAKKPAGAAKKPKK
AAGTATAKKSTKKTPKKAKKPAAAAGAKKAKSPKKAKATKAKKAPKSPAKAKTVKPKAAKPKTSKPKAAK
PKKTAAKKK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015787
ORF Size 657 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015787.1, NM_015787.2, NM_015787.3, NM_015787.4, NP_056602
RefSeq Size 1931
RefSeq ORF 660
Locus ID 50709
Cytogenetics 13|13 A3.1
MW 22.4 kDa
Gene Summary Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. [provided by RefSeq, Aug 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)