Ptges3 (NM_019766) Mouse Tagged ORF Clone

CAT#: MR215806

Ptges3 (Myc-DDK-tagged) - Mouse prostaglandin E synthase 3 (cytosolic) (Ptges3)

Product Images

Circular map for MR215806

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Ptges3
• Synonyms: 5730442A20Rik; cPGES; p23; Ptges; sid3177; Tebp
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR215806 representing NM_019766
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCAGCCTGCTTCTGCAAAGTGGTACGATCGAAGGGACTATGTATTCATTGAATTTTGTGTTGAAGACA
  GTAAAGATGTTAATGTAAACTTTGAAAAATCCAAACTTACTTTCAGTTGTCTTGGAGGAAGCGATAATTT
  TAAGCATTTAAATGAAATTGATCTTTTTCATTGTATCGATCCAAATGATTCCAAGCATAAAAGAACAGAC
  AGATCGATTTTATGTTGTTTGCGAAAAGGAGAATCCGGCCAGTCATGGCCTAGGTTAACAAAGGAAAGGG
  CAAAGCTTAATTGGCTCAGTGTGGACTTCAATAATTGGAAAGACTGGGAGGATGACTCAGATGAAGACAT
  GTCGAATTTTGACCGTTTCTCTGAGATGATGGATCACATGGGTGGTGATGAGGATGTAGATTTACCAGAA
  GTAGATGGAGCAGATGATGATTCACAAGACAGTGATGATGAAAAGATGCCAGATCTGGAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR215806 representing NM_019766
  Red=Cloning site Green=Tags(s)
  
  MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTD
  RSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMDHMGGDEDVDLPE
  VDGADDDSQDSDDEKMPDLE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_019766
• ORF Size: 480 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_019766.4, NP_062740.1
• RefSeq Size: 1954 bp
• RefSeq ORF: 483 bp
• Locus ID: 56351
• UniProt ID: Q9R0Q7
• Cytogenetics: 10 D3
• MW: 19.2 kDa
• Gene Summary: Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway.[UniProtKB/Swiss-Prot Function]