Emc6 (NM_025318) Mouse Tagged ORF Clone
CAT#: MR215036
- TrueORF®
Emc6 (Myc-DDK-tagged) - Mouse transmembrane protein 93 (Tmem93), transcript variant 2
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_025318" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Emc6 |
Synonyms | 0610009E20Rik; 0610025L18Rik; Tmem93 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR215036 representing NM_025318
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGCGGTGGTGGCCAAGCGGGAAGGGCCGCCGTTCATCAGCGAGGCAGCCGTGCGAGGCAACGCCG CGGTCCTGGATTACTGCCGGACCTCAGTGTCAGCGCTGTCCGGGGCCACCGCCGGCATCCTCGGCCTCAC CGGCCTCTACGGCTTCATCTTCTACCTGCTTGCCTCCGTCCTGCTCTCCCTGCTCCTCATTCTCAAAGCG GGAAGGAGGTGGAACAAATATTTTAAGTCACGAAGACCTCTCTTTACGGGAGGCCTCATTGGAGGCCTCT TCACCTACGTCCTCTTTTGGACCTTCCTCTATGGCATGGTGCACGTCTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR215036 representing NM_025318
Red=Cloning site Green=Tags(s) MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKA GRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_025318 |
ORF Size | 330 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_025318.3, NP_079594.1 |
RefSeq Size | 1353 bp |
RefSeq ORF | 333 bp |
Locus ID | 66048 |
UniProt ID | Q9CQW0 |
Cytogenetics | 11 B4 |
MW | 12.5 kDa |
Gene Summary | Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues. Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices. It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors. By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MG200421 | Emc6 (tGFP-tagged) - Mouse transmembrane protein 93 (Tmem93) |
USD 350.00 |
|
MG215036 | Emc6 (tGFP-tagged) - Mouse transmembrane protein 93 (Tmem93) transcript variant 2, (10ug) |
USD 350.00 |
|
MR215036L3 | Lenti ORF clone of Emc6 (Myc-DDK-tagged) - Mouse transmembrane protein 93 (Tmem93), transcript variant 2 |
USD 450.00 |
|
MR215036L4 | Lenti ORF clone of Emc6 (mGFP-tagged) - Mouse transmembrane protein 93 (Tmem93), transcript variant 2 |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review