Prkca (NM_011101) Mouse Tagged ORF Clone

CAT#: MR209931

  • TrueORF®

Prkca (Myc-DDK-tagged) - Mouse protein kinase C, alpha (Prkca)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_011101" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 615.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Prkca"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Prkca
Synonyms AI875142; Pkca
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR209931 representing NM_011101
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGACGTTTACCCGGCCAACGACTCCACGGCGTCTCAGGACGTGGCCAACCGCTTCGCCCGCAAAG
GGGCGCTGAGGCAGAAGAACGTGCATGAGGTGAAAGACCACAAATTCATCGCCCGCTTCTTCAAGCAACC
CACCTTCTGCAGCCACTGCACCGACTTCATCTGGGGGTTTGGGAAACAAGGCTTCCAGTGCCAAGTTTGC
TGTTTTGTGGTTCATAAGAGGTGCCATGAGTTCGTTACGTTCTCTTGTCCGGGTGCGGATAAGGGACCTG
ACACTGACGACCCCAGGAGCAAGCACAAGTTCAAAATCCACACATACGGAAGCCCTACCTTCTGTGATCA
CTGTGGGTCCCTGCTCTATGGACTTATCCACCAAGGGATGAAATGTGACACCTGCGACATGAATGTTCAC
AAGCAGTGTGTGATCAATGTCCCTAGCCTCTGCGGAATGGATCACACAGAGAAGAGGGGGCGGATTTATC
TGAAGGCTGAGGTCACTGATGAAAAGCTCCACGTCACGGTACGAGATGCAAAAAATCTAATCCCTATGGA
TCCAAATGGGCTTTCGGATCCTTATGTGAAGCTGAAACTTATCCCTGACCCCAAGAATGAGAGCAAACAG
AAAACCAAAACCATCCGCTCCACACTGAATCCTCAGTGGAATGAGTCCTTCACGTTCAAATTAAAACCTT
CAGACAAAGACCGGCGACTGTCTGTAGAAATCTGGGACTGGGATCGGACGACTCGGAATGACTTCATGGG
ATCCCTTTCCTTTGGTGTCTCAGAGCTAATGAAGATGCCGGCCAGTGGATGGTATAAACTGCTCAACCAA
GAAGAGGGCGAATATTACAATGTGCCCATTCCAGAAGGAGATGAAGAAGGCAACATGGAACTCAGGCAGA
AGTTTGAGAAAGCCAAGCTAGGCCCTGCTGGTAACAAAGTCATCAGCCCTTCAGAAGACAGAAAGCAACC
ATCCAACAACCTGGACAGAGTGAAACTCACAGACTTCAACTTCCTCATGGTGCTGGGGAAGGGGAGTTTT
GGGAAGGTGATGCTTGCTGACAGGAAGGGAACGGAGGAACTGTACGCCATCAAGATCCTGAAGAAGGACG
TGGTGATCCAGGACGACGACGTGGAGTGCACCATGGTGGAGAAGCGCGTGCTGGCCCTGCTGGACAAGCC
GCCATTTCTGACACAGCTGCACTCCTGCTTCCAGACAGTGGACCGGCTGTACTTCGTCATGGAATACGTC
AACGGCGGGGACCTCATGTACCACATTCAGCAAGTCGGGAAATTTAAGGAGCCACAAGCAGTATTCTACG
CAGCCGAGATCTCCATCGGACTGTTCTTCCTTCATAAAAGAGGGATCATTTACAGGGATCTGAAGCTGGA
CAATGTCATGCTGGACTCAGAAGGGCACATCAAAATCGCCGACTTCGGGATGTGCAAGGAACACATGATG
GATGGAGTCACGACCAGGACCTTCTGTGGGACTCCGGACTACATTGCCCCAGAGATAATCGCTTACCAGC
CGTACGGGAAGTCTGTAGATTGGTGGGCGTACGGTGTGCTGCTGTACGAGATGCTAGCCGGGCAGCCTCC
GTTTGATGGTGAAGATGAAGATGAACTGTTTCAGTCTATAATGGAGCACAACGTGTCCTACCCCAAATCC
TTGTCCAAGGAAGCCGTCTCCATCTGCAAAGGACTTATGACCAAACACCCTGCCAAGCGGCTGGGCTGCG
GGCCCGAGGGAGAGAGGGATGTCAGAGAGCATGCCTTCTTCAGGAGGATCGACTGGGAGAAACTGGAGAA
CAGGGAGATCCAACCACCATTCAAGCCCAAAGTGTGTGGCAAAGGAGCAGAAAACTTTGACAAGTTCTTC
ACGCGAGGACAGCCTGTCTTAACACCACCAGATCAGCTGGTCATTGCTAACATAGACCAATCTGATTTTG
AAGGGTTCTCGTATGTCAACCCCCAGTTTGTGCACCCAATCTTGCAAAGTGCAGTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR209931 representing NM_011101
Red=Cloning site Green=Tags(s)

MADVYPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVC
CFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVH
KQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQ
KTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQ
EEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSF
GKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMM
DGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKS
LSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFF
TRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011101
ORF Size 2016 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_011101.3, NP_035231.2
RefSeq Size 8385 bp
RefSeq ORF 2019 bp
Locus ID 18750
UniProt ID P20444
Cytogenetics 11 70.8 cM
MW 77.3 kDa
Gene Summary Calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that is involved in positive and negative regulation of cell proliferation, apoptosis, differentiation, migration and adhesion, cardiac hypertrophy, angiogenesis, platelet function and inflammation, by directly phosphorylating targets such as RAF1, BCL2, CSPG4, TNNT2/CTNT, or activating signaling cascades involving MAPK1/3 (ERK1/2) and RAP1GAP. Depending on the cell type, is involved in cell proliferation and cell growth arrest by positive and negative regulation of the cell cycle. Can promote cell growth by phosphorylating and activating RAF1, which mediates the activation of the MAPK/ERK signaling cascade, and/or by up-regulating CDKN1A, which facilitates active cyclin-dependent kinase (CDK) complex formation. In cells stimulated by the phorbol ester PMA, can trigger a cell cycle arrest program which is associated with the accumulation of the hyper-phosphorylated growth-suppressive form of RB1 and induction of the CDK inhibitors CDKN1A and CDKN1B. Depending on the cell type, exhibits anti-apoptotic function and protects cells from apoptosis by suppressing the p53/TP53-mediated activation of IGFBP3, or mediates anti-apoptotic action by phosphorylating BCL2. During macrophage differentiation induced by macrophage colony-stimulating factor (CSF1), is translocated to the nucleus and is associated with macrophage development. After wounding, translocates from focal contacts to lamellipodia and participates in the modulation of desmosomal adhesion. Plays a role in cell motility by phosphorylating CSPG4, which induces association of CSPG4 with extensive lamellipodia at the cell periphery and polarization of the cell accompanied by increases in cell motility. During chemokine-induced CD4(+) T cell migration, phosphorylates CDC42-guanine exchange factor DOCK8 resulting in its dissociation from LRCH1 and the activation of GTPase CDC42 (By similarity). Negatively regulates myocardial contractility and positively regulates angiogenesis, platelet aggregation and thrombus formation in arteries. Mediates hypertrophic growth of neonatal cardiomyocytes, in part through a MAPK1/3 (ERK1/2)-dependent signaling pathway, and upon PMA treatment, is required to induce cardiomyocyte hypertrophy up to heart failure and death, by increasing protein synthesis, protein-DNA ratio and cell surface area. Regulates cardiomyocyte function by phosphorylating cardiac troponin T (TNNT2/CTNT), which induces significant reduction in actomyosin ATPase activity, myofilament calcium sensitivity and myocardial contractility. In angiogenesis, is required for full endothelial cell migration, adhesion to vitronectin (VTN), and vascular endothelial growth factor A (VEGFA)-dependent regulation of kinase activation and vascular tube formation. Involved in the stabilization of VEGFA mRNA at post-transcriptional level and mediates VEGFA-induced cell proliferation. In the regulation of calcium-induced platelet aggregation, mediates signals from the CD36/GP4 receptor for granule release, and activates the integrin heterodimer ITGA2B-ITGB3 through the RAP1GAP pathway for adhesion. During response to lipopolysaccharides (LPS), may regulate selective LPS-induced macrophage functions involved in host defense and inflammation. But in some inflammatory responses, may negatively regulate NF-kappa-B-induced genes, through IL1A-dependent induction of NF-kappa-B inhibitor alpha (NFKBIA/IKBA). Upon stimulation with 12-O-tetradecanoylphorbol-13-acetate (TPA), phosphorylates EIF4G1, which modulates EIF4G1 binding to MKNK1 and may be involved in the regulation of EIF4E phosphorylation. Phosphorylates KIT, leading to inhibition of KIT activity. Phosphorylates ATF2 which promotes cooperation between ATF2 and JUN, activating transcription.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.