Syk (NM_011518) Mouse Tagged ORF Clone

CAT#: MR209591

  • TrueORF®

Syk (Myc-DDK-tagged) - Mouse spleen tyrosine kinase (Sykb), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_011518" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 586.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Syk
Synonyms Sykb
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR209591 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGAAGTGCTGTGGACAGCGCCAACCACCTGACCTACCTTTTTGGCAACATCACCCGGGAAGAGG
CTGAAGACTACCTGGTCCAGGGAGGCATGACCGATGGGCTCTACCTGCTACGCCAGAGCCGCAATTACCT
GGGTGGTTTTGCTTTGTCGGTGGCTCACAACAGGAAGGCACACCACTACACCATCGAGAGGGAACTTAAT
GGCACCTACGCCATCTCCGGGGGCAGGGCCCATGCCAGCCCAGCAGACCTCTGCCATTACCACTCCCAGG
AACCTGATGGCCTTATCTGCCTCCTTAAGAAGCCCTTCAACCGGCCCCCGGGAGTACAGCCCAAGACCGG
ACCCTTTGAGGACCTGAAGGAGAACCTCATCAGGGAATATGTGAAACAGACCTGGAACCTTCAGGGCCAG
GCTCTGGAGCAAGCCATCATCAGCCAGAAGCCCCAGCTGGAGAAGCTGATCGCCACCACGGCCCATGAGA
AGATGCCCTGGTTCCATGGCAACATCTCCAGAGATGAATCAGAGCAGACGGTCCTCATAGGGTCAAAGAC
CAATGGAAAATTCCTGATCAGGGCCAGAGACAACAGCGGCTCCTATGCTCTGTGCCTGCTGCACGAAGGG
AAAGTATTGCACTACCGCATTGACAGGGACAAGACCGGGAAGCTCTCCATTCCTGAGGGGAAGAAGTTTG
ACACCCTCTGGCAGCTAGTGGAACATTACTCTTACAAGCCAGATGGGCTACTAAGAGTCCTCACGGTACC
ATGCCAAAAGATTGGTGCACAGATGGGCCACCCAGGAAGCCCAAATGCCCATCCCGTGACTTGGTCACCG
GGTGGAATAATCTCAAGGATCAAATCCTACTCCTTCCCAAAGCCTGGCCACAAAAAGCCTGCCCCACCCC
AAGGGAGCCGTCCAGAGAGCACTGTGTCCTTCAACCCCTATGAGCCAACGGGAGGGCCCTGGGGCCCAGA
CAGAGGCCTTCAGAGAGAAGCCCTGCCCATGGACACAGAGGTGTACGAGAGCCCTTATGCTGACCCTGAA
GAGATCCGGCCCAAAGAGGTCTACCTGGACAGGAGCCTGCTGACCCTGGAGGACAATGAACTGGGCTCCG
GTAACTTCGGGACTGTGAAAAAGGGATACTACCAAATGAAAAAAGTTGTGAAAACCGTGGCTGTGAAAAT
CCTGAAGAACGAGGCCAACGACCCGGCTTTGAAGGACGAGCTGCTGGCAGAGGCGAACGTCATGCAGCAG
CTGGACAACCCCTACATTGTGCGCATGATCGGAATCTGCGAGGCGGAGTCCTGGATGCTGGTGATGGAGA
TGGCGGAGCTGGGGCCGCTCAACAAGTACCTGCAGCAGAACAGGCACATTAAGGATAAGAACATCATAGA
GCTGGTTCACCAGGTTTCCATGGGGATGAAGTATTTGGAAGAGAGCAACTTTGTGCACAGAGATCTGGCT
GCGCGGAACGTGCTTCTGGTCACACAGCACTATGCCAAGATCAGCGATTTCGGTCTTTCCAAAGCCCTGC
GTGCTGATGAAAACTACTACAAGGCCCAGACCCACGGGAAGTGGCCCGTGAAGTGGTACGCCCCCGAATG
CATCAACTACTACAAGTTCTCCAGTAAGAGTGACGTCTGGAGCTTCGGAGTCCTGATGTGGGAAGCGTTC
TCCTATGGGCAGAAGCCCTACAGAGGGATGAAAGGGAGCGAAGTGACCGCCATGCTGGAGAAAGGAGAGC
GGATGGGGTGCCCTGCAGGATGCCCGAGAGAGATGTACGACCTGATGAACCTGTGCTGGACTTACGATGT
GGAGAACAGGCCAGGATTCACAGCTGTGGAACTGAGGCTTCGCAATTACTACTACGACGTGGTTAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR209591 protein sequence
Red=Cloning site Green=Tags(s)

MAGSAVDSANHLTYLFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKAHHYTIERELN
GTYAISGGRAHASPADLCHYHSQEPDGLICLLKKPFNRPPGVQPKTGPFEDLKENLIREYVKQTWNLQGQ
ALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQTVLIGSKTNGKFLIRARDNSGSYALCLLHEG
KVLHYRIDRDKTGKLSIPEGKKFDTLWQLVEHYSYKPDGLLRVLTVPCQKIGAQMGHPGSPNAHPVTWSP
GGIISRIKSYSFPKPGHKKPAPPQGSRPESTVSFNPYEPTGGPWGPDRGLQREALPMDTEVYESPYADPE
EIRPKEVYLDRSLLTLEDNELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQ
LDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLEESNFVHRDLA
ARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAF
SYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFTAVELRLRNYYYDVVN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011518
ORF Size 1890 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_011518.1, NM_011518.2, NP_035648.2
RefSeq Size 5148 bp
RefSeq ORF 1890 bp
Locus ID 20963
UniProt ID P48025
Cytogenetics 13 27.41 cM
MW 71.3 kDa
Gene Summary Non-receptor tyrosine kinase which mediates signal transduction downstream of a variety of transmembrane receptors including classical immunoreceptors like the B-cell receptor (BCR). Regulates several biological processes including innate and adaptive immunity, cell adhesion, osteoclast maturation, platelet activation and vascular development. Assembles into signaling complexes with activated receptors at the plasma membrane via interaction between its SH2 domains and the receptor tyrosine-phosphorylated ITAM domains. The association with the receptor can also be indirect and mediated by adapter proteins containing ITAM or partial hemITAM domains. The phosphorylation of the ITAM domains is generally mediated by SRC subfamily kinases upon engagement of the receptor. More rarely signal transduction via SYK could be ITAM-independent. Direct downstream effectors phosphorylated by SYK include VAV1, PLCG1, PI-3-kinase, LCP2 and BLNK. Initially identified as essential in B-cell receptor (BCR) signaling, it is necessary for the maturation of B-cells most probably at the pro-B to pre-B transition. Activated upon BCR engagement, it phosphorylates and activates BLNK an adapter linking the activated BCR to downstream signaling adapters and effectors. It also phosphorylates and activates PLCG1 and the PKC signaling pathway. It also phosphorylates BTK and regulates its activity in B-cell antigen receptor (BCR)-coupled signaling. In addition to its function downstream of BCR plays also a role in T-cell receptor signaling. Plays also a crucial role in the innate immune response to fungal, bacterial and viral pathogens. It is for instance activated by the membrane lectin CLEC7A. Upon stimulation by fungal proteins, CLEC7A together with SYK activates immune cells inducing the production of ROS. Also activates the inflammasome and NF-kappa-B-mediated transcription of chemokines and cytokines in presence of pathogens. Regulates neutrophil degranulation and phagocytosis through activation of the MAPK signaling cascade. Required for the stimulation of neutrophil phagocytosis by IL15 (By similarity). Also mediates the activation of dendritic cells by cell necrosis stimuli. Also involved in mast cells activation. Involved in interleukin-3/IL3-mediated signaling pathway in basophils (PubMed:19098920). Also functions downstream of receptors mediating cell adhesion. Relays for instance, integrin-mediated neutrophils and macrophages activation and P-selectin receptor/SELPG-mediated recruitment of leukocytes to inflammatory loci. Plays also a role in non-immune processes. It is for instance involved in vascular development where it may regulate blood and lymphatic vascular separation. It is also required for osteoclast development and function. Functions in the activation of platelets by collagen, mediating PLCG2 phosphorylation and activation. May be coupled to the collagen receptor by the ITAM domain-containing FCER1G. Also activated by the membrane lectin CLEC1B that is required for activation of platelets by PDPN/podoplanin. Involved in platelet adhesion being activated by ITGB3 engaged by fibrinogen. Together with CEACAM20, enhances production of the cytokine CXCL8/IL-8 via the NFKB pathway and may thus have a role in the intestinal immune response (PubMed:26195794).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.