Dcbld1 (BC026771) Mouse Tagged ORF Clone

CAT#: MR206887

Dcbld1 (Myc-DDK-tagged) - Mouse discoidin, CUB and LCCL domain containing 1 (cDNA clone MGC:30907 IMAGE:4014778)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 98.00

USD 670.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Dcbld1 (BC026771) Mouse Tagged ORF Clone
Symbol Dcbld1
Vector pCMV6-Entry
Sequence Data
>MR206887 representing BC026771
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGACCGGGGCTGGTGGGCCGAGTGTCCTGGCGCTGCTGTTCGCCGTGTGTGCTCCGCTCCGGTTGC
AGGCGGAGGAGCTGGGTCCATATTGTGGGAGTTGGGCTGTTCCCAAAGAACTCCGGCTGAACTCAAACGA
AGTGACTGTCCTCTTCAAGAGTGGATCTCACATTTCTGGCCGGGGCTTTCTGCTGACCTACGCCAGCAGT
GACCATCCAGATTTAATAACCTGTTTGGAACGAGGCAGCCATTATTTCGAGGAAAAATACAGCAAATTCT
GCCCAGCTGGCTGTAGAGACATAGCAGGAGATATTTCTGGGAATACAAAAGATGGCTACAGAGATACCTC
TTTATTGTGCAAAGCTGCCATCCACGCAGGGATCATCACAGATGAACTAGGTGGCCACATCAACTTGCTT
CAGAGCAAAGGGATAAGTCACTATGAAGGACTCCTGGCCAATGGCGTGCTCTCCCGGCATGGTTCTTTGT
CGGAAAAGCGATTTCTTTTTACAACCCCAGGAATGAATATTACAACTGTGGCGATTCCATCAGTGATCTT
CATCGCCCTCCTTCTGACTGGAATGGGGATCTTTGCAATCTGTAGAAAGAGGAAAAAGAAAGGAAATCCA
TATGTGTCAGCTGACGCTCAGAAAACAGGCTGTTGGAAGCAGATTAAATATCCCTTTGCCAGGCATCAGT
CGACGGAATTTACCATCAGCTATGACAATGAAAAAGAGATGACACAAAAGTTGGATCTCATCACTAGTGA
TATGGCAGATTATCAGCAGCCTCTCATGATTGGCACAGGCACAGTCGCGAGAAAGGGCTCTACCTTCCGA
CCCATGGACACAGACACTGAGGAGGTCAGAGTGAACACTGAGGCCAGCGGCCACTATGACTGTCCTCACC
GCCCGGGCCGCCATGAGTACGCACTGCCTTTGACGCACTCAGAACCTGAGTATGCCACACCTATCGTGGA
GCGGCACCTGCTGCGAGCTCACACCTTCTCCACACAGAGCGGCTACCGAGTCCCTGGGCCCAGGCCCACT
CACAAACACTCCCATTCCTCTGGAGGCTTTCCTCCTGCTACAGGAGCCACCCAGATTGAAAGCTATCAGA
GGCCAGCAAGCCCCAAGCCTGTGGGTGGTGGCTATGACAAGCCTGCTGCTAGCAGCTTCTTGGACAGCAG
AGACCCAGCCTCTCAGTCACAGATGACTTCCGGGGGAGATGATGGTTATTCGGCACCCAGAACCGGTCTT
GCGCCCCTCAACCAGACGGCCATGACTGCTCTTTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR206887 representing BC026771
Red=Cloning site Green=Tags(s)

MGTGAGGPSVLALLFAVCAPLRLQAEELGPYCGSWAVPKELRLNSNEVTVLFKSGSHISGRGFLLTYASS
DHPDLITCLERGSHYFEEKYSKFCPAGCRDIAGDISGNTKDGYRDTSLLCKAAIHAGIITDELGGHINLL
QSKGISHYEGLLANGVLSRHGSLSEKRFLFTTPGMNITTVAIPSVIFIALLLTGMGIFAICRKRKKKGNP
YVSADAQKTGCWKQIKYPFARHQSTEFTISYDNEKEMTQKLDLITSDMADYQQPLMIGTGTVARKGSTFR
PMDTDTEEVRVNTEASGHYDCPHRPGRHEYALPLTHSEPEYATPIVERHLLRAHTFSTQSGYRVPGPRPT
HKHSHSSGGFPPATGATQIESYQRPASPKPVGGGYDKPAASSFLDSRDPASQSQMTSGGDDGYSAPRTGL
APLNQTAMTALL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN BC026771
ORF Size 1296 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC026771
RefSeq Size 2846
RefSeq ORF 1298
Locus ID 66686
Cytogenetics 10|10 B3
MW 104.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)