Angptl7 (NM_001039554) Mouse Tagged ORF Clone

CAT#: MR205028

Angptl7 (Myc-DDK-tagged) - Mouse angiopoietin-like 7 (Angptl7)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 269.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Angptl7 (NM_001039554) Mouse Tagged ORF Clone
Symbol Angptl7
Vector pCMV6-Entry
Sequence Data
>MR205028 representing NM_001039554
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGAGGGAGACCTGGCTATGTGTTATCCTTGTAGCCTTTGTCAGCCACCCAGTGTGGCTGCAGAAGC
CTCATAAACGCAAGACACAGCTCAAAGCAGCGGGCTGCTGTGAGGAGATGAGGGAGCTCAAAGCCCAGGT
GGCCAACCTCAGCAGTCTGCTGGGAGAGCTGAGCAGGAAGCAGGAGAGCGACTGGGTCAGTGTGGTCATG
CAGGTGATGGAGCTGGAGAGCAGCAGCAAGCACATGGAGTCTCGGCTCAGCACTGCCGAGAGCAAGTACT
CTGAGATGAACAACCAGATTGACATCATGCAGCTGCAGGCTGCGCAGACCGTCACGCAGACCTCGGCAGA
TGCCATCTATGACTGTTCTTCCCTGTACCAGAAGAACTACCGAATCTCTGGAGTGTACAAGCTTCCTCCT
GACGAGTTCCTGGGGAGCCCTGAGCTAGAGGTGTTCTGTGACATGGAAACTTCAGGAGGAGGCTGGACCA
TCATCCAGAGACGTAAGAGTGGCCTTGTCTCCTTCTACCAAGACTGGAGACAGTATAAGCAAGGGTTTGG
CAGCATCCGAGGTGACTTCTGGCTGGGGAATGAACATATCCACCGGCTCACCAGGCAGCCAAGCCGGCTT
CGTGTGGAGCTGGAGGACTGGGAGGGCAATGCACGCTACGCAGAGTATAGCTACTTTGCGTTGGGCAATG
AACTGAACAGCTACCGCCTCTTCCTGGGGAACTACAGTGGCAACGTGGGGAAGGACGCCCTCCTCTACCA
TAACAACACCGTCTTCAGCACCAAGGACAAGGACAACGACAACTGCTTGGACAAGTGCGCACAGCTCCGA
AAAGGTGGCTACTGGTACAACTGCTGCACAGACTCCAACCTCAATGGGGTGTACTACCGCCTTGGCGAGC
ACCGAAAGCACATGGATGGCATCAGCTGGTATGGCTGGCATGGAGCCAACTATTCCCTCAAACGTGTGGA
AATGAAGATCCGCCCAGAAGCCTTCAAGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205028 representing NM_001039554
Red=Cloning site Green=Tags(s)

MLRETWLCVILVAFVSHPVWLQKPHKRKTQLKAAGCCEEMRELKAQVANLSSLLGELSRKQESDWVSVVM
QVMELESSSKHMESRLSTAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPP
DEFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWRQYKQGFGSIRGDFWLGNEHIHRLTRQPSRL
RVELEDWEGNARYAEYSYFALGNELNSYRLFLGNYSGNVGKDALLYHNNTVFSTKDKDNDNCLDKCAQLR
KGGYWYNCCTDSNLNGVYYRLGEHRKHMDGISWYGWHGANYSLKRVEMKIRPEAFKP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001039554
ORF Size 1011 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001039554.1, NM_001039554.2, NM_001039554.3, NP_001034643
RefSeq Size 2063
RefSeq ORF 1014
Locus ID 654812
Cytogenetics 4|4 E2
MW 39.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)