(BC030392) Mouse Tagged ORF Clone

CAT#: MR203591

(Myc-DDK-tagged) - Mouse cDNA clone MGC:40659 IMAGE:4923983

Change vector?

  • TrueORF®

USD 691.00


Availability*
5 Days

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name (BC030392) Mouse Tagged ORF Clone
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR203591 representing BC030392
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACTCTTCTCCAGGCTTCATGACTGTGATGCTCCTCATATTCACAATGGCCCAGGGGGACTCAGTGA
CTCAGACGGAAGGTCAAGTGGCCCTCTCAGAAGAGGACTTTCTTACGATACACTGCAACTACTCAGCCTC
AGGGTACCCAGCTCTGTTCTGGTATGTGCAGTATCCCGGAGAAGGGCCACAGTTCCTCTTTAGAGCCTCA
AGGGACAAAGAGAAAGGAAGCAGCAGAGGGTTTGAAGCCACATACAATAAAGAAGCCACCTCCTTCCACT
TGCAGAAAGCCTCAGTGCAAGAGTCAGACTCGGCTGTGTACTACTGTGCTCTGAGGAATTATGGGGGCAG
TGGCAACAAGCTCATCTTTGGAACTGGCACTCTGCTTTCTGTCAAGCCAAACATCCAGAACCCAGAACCT
GCTGTGTACCAGTTAAAAGATCCTCGGTCTCAGGACAGCACCCTCTGCCTGTTCACCGACTTTGACTCCC
AAATCAATGTGCCGAAAACCATGGAATCTGGAACGTTCATCACTGACAAAACTGTGCTGGACATGAAAGC
TATGGATTCCAAGAGCAATGGGGCCATTGCCTGGAGCAACCAGACAAGCTTCACCTGCCAAGATATCTTC
AAAGAGACCAACGCCACCTACCCCAGTTCAGACGTTCCCTGTGATGCCACGTTGACCGAGAAAAGCTTTG
AAACAGATATGAACCTAAACTTTCAAAACCTGTCAGTTATGGGACTCCGAATCCTCCTGCTGAAAGTAGC
GGGATTTAACCTGCTCATGACGCTGAGGCTGTGGTCCAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR203591 representing BC030392
Red=Cloning site Green=Tags(s)

MNSSPGFMTVMLLIFTMAQGDSVTQTEGQVALSEEDFLTIHCNYSASGYPALFWYVQYPGEGPQFLFRAS
RDKEKGSSRGFEATYNKEATSFHLQKASVQESDSAVYYCALRNYGGSGNKLIFGTGTLLSVKPNIQNPEP
AVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIF
KETNATYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN BC030392
ORF Size 810 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC030392
RefSeq Size 1340
MW 49.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.