Barx2 (NM_013800) Mouse Tagged ORF Clone

CAT#: MR203352

  • TrueORF®

Barx2 (Myc-DDK-tagged) - Mouse BarH-like homeobox 2 (Barx2)

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_013800" in other vectors (3)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Barx2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Barx2
Synonyms 2310006E12Rik; Barx2b
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR203352 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCGATGAGATCCTCTCCAAGGAGACCTGCGACTACTTTGAGAAACTTTCCCTCTACTCTGTGTGCC
CGTCGCTGGTGGTGCGACCCAAGCCCCTGCACTCTTGTACCGGTTCCCCTTCCCTACGGGCATATCCTCT
CCTGTCTGTGATCACCCGGCAGCCCACAGTCATCTCCCACCTGGTTCCCACCGGCTCGGGACTCACCCCA
GTGTTAACTCGCCATCCAGTCGCCGCCTCGGAGGCGGCGGCTGCTGCTGCTGCTGAGACCCCTGGTGGTG
AGGCGTTAGCCAGCAGCGAGTCAGAGACAGAACAGCCCACGCCCAGGCAGAAGAAACCACGCAGAAGTCG
CACCATCTTCACCGAGCTGCAGCTCATGGGCCTAGAGAAGAAATTCCAGAAGCAGAAGTATTTGTCTACC
CCAGACAGGTTGGACTTGGCCCAGTCTCTGGGACTCACTCAGCTGCAAGTGAAGACTTGGTATCAGAATC
GCAGGATGAAATGGAAGAAGATGGTCCTTAAAGGTGGACAGGAAGCACCCACAAAACCTAAGGGGCGCCC
TAAGAAGAACTCCATTCCCACATCAGAGGAGATTGAAGCTGAAGAGAAGATGAACAGCCAGGCTCAGAGC
CAGGAGCTGCTGGAATCCTCGGAGAGACAGGAGGAGCCCTGTGATACCCAGGAGCCCAAAGCGTGCCTTG
TCCCCTTGGAGGTGGCAGAACCTATTCACCAGCCCCAGGAGTTATCAGAAGCTTCCTCTGAACCCCCACC
ATTAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR203352 protein sequence
Red=Cloning site Green=Tags(s)

MIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAYPLLSVITRQPTVISHLVPTGSGLTP
VLTRHPVAASEAAAAAAAETPGGEALASSESETEQPTPRQKKPRRSRTIFTELQLMGLEKKFQKQKYLST
PDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQS
QELLESSERQEEPCDTQEPKACLVPLEVAEPIHQPQELSEASSEPPPLS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_013800
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013800.2, NP_038828.2
RefSeq Size 1791 bp
RefSeq ORF 852 bp
Locus ID 12023
UniProt ID O08686
Cytogenetics 9 A4
MW 28.7 kDa
Gene Summary Transcription factor. Binds optimally to the DNA consensus sequence 5'-YYTAATGRTTTTY-3'. May control the expression of neural adhesion molecules such as L1 or Ng-CAM during embryonic development of both the central and peripherical nervous system. May be involved in controlling adhesive processes in keratinizing epithelia.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.