Dcun1d5 (NM_029775) Mouse Tagged ORF Clone

CAT#: MR202903

Dcun1d5 (Myc-DDK-tagged) - Mouse DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (Dcun1d5)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 149.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Dcun1d5 (NM_029775) Mouse Tagged ORF Clone
Symbol Dcun1d5
Synonyms 3110001A18Rik; 4833420K19Rik; AW060460; D430047L21Rik
Vector pCMV6-Entry
Sequence Data
>MR202903 representing NM_029775
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGTGAAGAAGAAGAGAAAAGCTCCCGGAGTGGCAGCGGCGGTCGCGGAAGACGCGGGCCTCAAAA
AGTGTAAAATCCCCAGCTATTGCAGATCCCAGCCTCCTGCTAGACTCATCAGTGGAGAGGAAGATTTTTC
AAGAAAGAAGTGCCTGGCTTGGTTTTATGAGTATGCAGGTCCTGATGAAGTTGTAGGGCCAGAAGGAATG
GAAAAATTTTGTGAAGACATTGGTGTTGAACCTGAAAACATTATTATGTTAGTTTTAGCATGGAAATTGG
AGGCTGAAAGCATGGGATTTTTTACCAAGGAAGAATGGTTAAAGGGAATGACCTCATTACAGTGTGACTG
CACAGAAAAGTTACAGAGCAGGTTTGATTTTCTGCGCTCTCAGCTGAATGACATCTCATCTTTTAAGAAT
ATCTACAGATATGCCTTTGATTTTGCAAGGGATAAAGATCAGAGAAGCCTTGATATTGATACTGCGAAGT
CTATGTTAGCTCTGCTGCTTGGGAGAACATGGCCACTCTTTTCAGTATTTTACCAGTACCTGGAGCAATC
AAAGTATCGTGTTATGAACAAAGATCAGTGGTACAATGTATTAGAATTCAGCAGAACAGTTCATGCCGAT
CTTAGTAACTACGATGAAGACGGTGCTTGGCCTGTTCTTCTTGATGAATTTGTTGAGTGGCAAAAAATCC
GTCAAACATCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202903 representing NM_029775
Red=Cloning site Green=Tags(s)

MPVKKKRKAPGVAAAVAEDAGLKKCKIPSYCRSQPPARLISGEEDFSRKKCLAWFYEYAGPDEVVGPEGM
EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQSRFDFLRSQLNDISSFKN
IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD
LSNYDEDGAWPVLLDEFVEWQKIRQTS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_029775
ORF Size 711 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_029775.1, NM_029775.2, NP_084051
RefSeq Size 1201
RefSeq ORF 714
Locus ID 76863
Cytogenetics 9|9 A1
MW 28 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)