Clec4e (NM_019948) Mouse Tagged ORF Clone

CAT#: MR202353

Clec4e (Myc-DDK-tagged) - Mouse C-type lectin domain family 4, member e (Clec4e)

Product Images

Circular map for MR202353

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Clec4e
• Synonyms: C86253; Clecsf9; Mincle
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR202353 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAATTCAACCAAATCGCCTGCATCCCACCACACAGAGAGAGGATGCTTCAAAAACTCCCAAGTGCTCT
  CCTGGACGATAGCCGGGGCCTCCATCCTGTTTCTCAGTGGCTGTTTCATCACCAGATGTGTCGTAACATA
  TCGCAGCTCTCAAATTTCCGGGCAGAACTTACAGCCACATAGAAATATTAAGGAGCTTTCCTGCTACAGT
  GAGGCATCAGGTTCAGTCAAGAATTGCTGTCCTTTGAACTGGAAACATTATCAATCTAGTTGTTATTTTT
  TCTCTACGACAACCTTGACCTGGTCATCAAGTTTAAAGAATTGCTCAGACATGGGGGCTCACCTGGTGGT
  TATCGACACACAGGAAGAGCAGGAATTCCTTTTTCGCACAAAACCTAAAAGGAAAGAGTTTTATATTGGA
  CTGACAGACCAGGTGGTGGAGGGTCAGTGGCAATGGGTGGATGATACACCTTTCACAGAGTCCCTGAGCT
  TCTGGGATGCTGGGGAGCCCAACAATATAGTTTTGGTGGAGGACTGTGCCACCATAAGGGACTCTTCAAA
  CTCCAGGAAGAACTGGAATGATATACCCTGTTTCTACAGTATGCCTTGGATTTGTGAGATGCCAGAAATA
  AGTCCTCTGGAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR202353 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNSTKSPASHHTERGCFKNSQVLSWTIAGASILFLSGCFITRCVVTYRSSQISGQNLQPHRNIKELSCYS
  EASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIG
  LTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEI
  SPLD
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_019948
• ORF Size: 645 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_019948.2, NP_064332.1
• RefSeq Size: 2519 bp
• RefSeq ORF: 645 bp
• Locus ID: 56619
• UniProt ID: Q9R0Q8
• Cytogenetics: 6 58.35 cM
• MW: 24.4 kDa
• Gene Summary: A calcium-dependent lectin that acts as a pattern recognition receptor of the innate immune system. Recognizes damage-associated molecular patterns (DAMPs) of abnormal self and pathogen-associated molecular patterns (PAMPs) of bacteria and fungi (PubMed:18509109, PubMed:19171887, PubMed:23602766, PubMed:18776906). The PAMPs notably include mycobacterial trehalose 6,6'-dimycolate (TDM), a cell wall glycolipid with potent adjuvant immunomodulatory functions (PubMed:23602766). Interacts with signaling adapter Fc receptor gamma chain/FCER1G to form a functional complex in myeloid cells (PubMed:23602766, PubMed:18776906). Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes (PubMed:23602766). Specifically recognizes alpha-mannose residues on pathogenic fungi of the genus Malassezia and mediates macrophage activation (PubMed:19171887). Through recognition of DAMPs released upon nonhomeostatic cell death, enables immune sensing of damaged self and promotes inflammatory cell infiltration into the damaged tissue (PubMed:18776906).[UniProtKB/Swiss-Prot Function]