Bok (NM_016778) Mouse Tagged ORF Clone

CAT#: MR202338

  • TrueORF®

Bok (Myc-DDK-tagged) - Mouse BCL2-related ovarian killer protein (Bok)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_016778" in other vectors (3)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


BOK Antibody - middle region
    • 100 ul

USD 539.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Bok
Synonyms matador; mtd
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR202338 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTGCTGCGGCGCTCTTCTGTCTTTGCAGCGGAGATCATGGACGCCTTTGATCGCTCGCCCACAG
ACAAGGAGCTGGTGGCCCAGGCTAAGGCACTAGGCCGGGAGTACGTGCACGCGCGGCTTTTGCGCGCCGG
CCTCTCCTGGAGCGCTCCAGAGCGTGCCTCGCCTGCCCCTGGAGGACGCTTGGCAGAGGTGTGCACAGTG
CTGCTGCGCTTGGGAGATGAGCTGGAGCAGATCCGTCCCAGCGTATACCGGAACGTGGCCCGGCAGCTGC
ACATCCCCCTGCAGTCGGAGCCTGTGGTGACGGATGCCTTCCTGGCAGTGGCAGGCCACATCTTCTCAGC
AGGTATCACATGGGGCAAGGTAGTGTCCCTGTATTCCGTGGCCGCGGGGCTAGCGGTGGACTGTGTCCGG
CAGGCTCAGCCTGCCATGGTTCATGCCCTGGTTGACTGCCTGGGGGAATTTGTACGCAAGACCTTGGCTA
CCTGGCTTCGGAGGCGTGGCGGATGGACGGATGTCCTCAAGTGTGTGGTCAGCACAGATCCTGGCTTCCG
CTCCCACTGGCTCGTGGCCACGCTCTGCAGCTTTGGCCGCTTCCTGAAGGCAGCATTCTTCCTGTTGTTG
CCAGAGAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR202338 protein sequence
Red=Cloning site Green=Tags(s)

MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERASPAPGGRLAEVCTV
LLRLGDELEQIRPSVYRNVARQLHIPLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYSVAAGLAVDCVR
QAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGFRSHWLVATLCSFGRFLKAAFFLLL
PER

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016778
ORF Size 642 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016778.1, NM_016778.2, NM_016778.3, NP_058058.1
RefSeq Size 1432 bp
RefSeq ORF 642 bp
Locus ID 51800
UniProt ID O35425
Cytogenetics 1 D
MW 23.5 kDa
Gene Summary Apoptosis regulator that functions through different apoptotic signaling pathways (PubMed:23429263, PubMed:26015568, PubMed:26949185, PubMed:27098698, PubMed:9535847). Plays a roles as pro-apoptotic protein that positively regulates intrinsic apoptotic process in a BAX- and BAK1-dependent manner or in a BAX- and BAK1-independent manner (PubMed:23429263, PubMed:26015568, PubMed:26949185). In response to endoplasmic reticulum stress promotes mitochondrial apoptosis through downstream BAX/BAK1 activation and positive regulation of PERK-mediated unfolded protein response (PubMed:26015568). Activates apoptosis independently of heterodimerization with survival-promoting BCL2 and BCL2L1 through induction of mitochondrial outer membrane permeabilization, in a BAX- and BAK1-independent manner, in response to inhibition of ERAD-proteasome degradation system, resulting in cytochrome c release (PubMed:9535847, PubMed:26949185). In response to DNA damage, mediates intrinsic apoptotic process in a TP53-dependent manner. Plays a role in granulosa cell apoptosis by CASP3 activation (By similarity). Plays a roles as anti-apoptotic protein during neuronal apoptotic process, by negatively regulating poly ADP-ribose polymerase-dependent cell death through regulation of neuronal calcium homeostasis and mitochondrial bioenergetics in response to NMDA excitation (PubMed:27098698). In addition to its role in apoptosis, may regulate trophoblast cell proliferation during the early stages of placental development, by acting on G1/S transition through regulation of CCNE1 expression.May also play a role as an inducer of autophagy by disrupting interaction between MCL1 and BECN1 (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.