Cbfb (NM_022309) Mouse Tagged ORF Clone

CAT#: MR201754

Cbfb (Myc-DDK-tagged) - Mouse core binding factor beta (Cbfb), transcript variant 1

Product Images

Circular map for MR201754

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cbfb
• Synonyms: AI893578; PEA2; Pebp2; PEBP2b; Pebpb2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201754 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCGCGCGTCGTCCCGGACCAGAGGAGCAAGTTCGAGAACGAGGAGTTCTTCAGGAAGCTGAGCCGCG
  AGTGCGAGATTAAGTACACGGGCTTCAGGGACCGGCCCCACGAGGAGCGCCAGACACGCTTCCAGAACGC
  CTGCCGCGACGGTCGCTCGGAGATCGCTTTTGTGGCTACAGGAACCAATCTGTCTCTCCAGTTTTTTCCG
  GCCAGCTGGCAGGGAGAACAGCGACAAACACCTAGCCGGGAATATGTCGACTTAGAGAGAGAAGCAGGCA
  AGGTATACTTGAAGGCTCCCATGATTCTGAATGGAGTGTGTGTTATATGGAAGGGCTGGATTGATCTCCA
  CAGATTGGATGGTATGGGTTGCCTGGAGTTTGATGAGGAGCGAGCCCAGCAGGAAGATGCATTAGCACAA
  CAGGCCTTTGAAGAGGCTCGAAGAAGAACTCGAGAATTTGAGGATAGAGACAGGTCTCACCGGGAGGAAA
  TGGAGGCAAGAAGACAGCAAGACCCTAGTCCTGGTTCTAACTTAGGTGGCGGTGATGATCTCAAACTTCG
  T
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201754 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIAFVATGTNLSLQFFP
  ASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLHRLDGMGCLEFDEERAQQEDALAQ
  QAFEEARRRTREFEDRDRSHREEMEARRQQDPSPGSNLGGGDDLKLR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_022309
• ORF Size: 564 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_022309.4
• RefSeq Size: 2893 bp
• RefSeq ORF: 564 bp
• Locus ID: 12400
• UniProt ID: Q08024
• Cytogenetics: 8 53.04 cM
• MW: 22 kDa
• Gene Summary: Forms the heterodimeric complex core-binding factor (CBF) with RUNX family proteins (RUNX1, RUNX2, and RUNX3). RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters (Probable). CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation (PubMed:18258917).[UniProtKB/Swiss-Prot Function]