Rangrf (NM_021329) Mouse Tagged ORF Clone

CAT#: MR201721

Rangrf (Myc-DDK-tagged) - Mouse RAN guanine nucleotide release factor (Rangrf)

Product Images

Circular map for MR201721

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Rangrf
• Synonyms: 2400006H24Rik; Mog1; Rangnrf
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201721 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGCCCAACAGAAACTGTCCACTGTTCGGAGGCGCCTTCTCCGCCATCCTCCCTACAGGGGCCATTG
  ATGTGAGTGACCTCCGACCGGTGCCAGACAACCAAGAAGTTTTCTGCCATCCTGTGACCGACCAGAGTCT
  GATCATAGAACTTCTGGAGCTGCAGGCCCACGTGCAGGGCGAAGCGGCTGCGCGGTACCATTTTGAGGAC
  GTTGGCCGGGTGCAGGGGGCTAGGGCTGTGCACGTGCTATCTGTGCAGCCTCTCTGTTTGGAGAACTTAT
  CCCTGAGAGGCTGCTGTCAGGATGCCTGGTCCCTTTCTGGCAAGCAGCAGGTAGCTAAAGAAAACCAGCA
  GGTAGCAAAGGATGTCACACTGCATCAGGCCTTGCTGCGGCTGCCCCAGTATCAGACTGATCTTTTGCTC
  ACCTTCAATCAGCCCCCGTGTCACAGCAGGTCTCTTGGCCCTGAAAATCTGTCATGTCCACCTTGGAGCC
  TGAGTAACTTTGAACAGCTGGTAACTAGTTTGACTCTTCATGATCCCAACCTCTTTGGTCCCCAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201721 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPNRNCPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIIELLELQAHVQGEAAARYHFED
  VGRVQGARAVHVLSVQPLCLENLSLRGCCQDAWSLSGKQQVAKENQQVAKDVTLHQALLRLPQYQTDLLL
  TFNQPPCHSRSLGPENLSCPPWSLSNFEQLVTSLTLHDPNLFGPQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_021329
• ORF Size: 558 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_021329.3
• RefSeq Size: 845 bp
• RefSeq ORF: 558 bp
• Locus ID: 57785
• UniProt ID: Q9JIB0
• Cytogenetics: 11 B3
• MW: 20.4 kDa
• Gene Summary: May regulate the intracellular trafficking of RAN (PubMed:10811801, PubMed:11733047). Promotes guanine nucleotide release from RAN and inhibits binding of new GTP by preventing the binding of the RAN guanine nucleotide exchange factor RCC1 (PubMed:10811801, PubMed:11733047). Regulates the levels of GTP-bound RAN in the nucleus, and thereby plays a role in the regulation of RAN-dependent mitotic spindle dynamics (By similarity). Enhances the expression of SCN5A at the cell membrane in cardiomyocytes (PubMed:18184654, PubMed:23420830).[UniProtKB/Swiss-Prot Function]