Phca (BC023924) Mouse Tagged ORF Clone

CAT#: MR201511

Phca (Myc-DDK-tagged) - Mouse phytoceramidase, alkaline (cDNA clone MGC:36600 IMAGE:5324078)

Product Images

Circular map for MR201511

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Phca
• Synonyms: 1110057L18Rik; 5430429L08Rik; AV015045; Phca
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201511 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTCCGGCTGTGGACCGCAAAGGCTATTGGGGCCCCACGACCTCCACATTGGACTGGTGTGAGGAGA
  ACTATGTGGTGACCTTGTTCGTCGCTGAGTTCTGGAATACAGTGAGTAACCTGATTATGATCATACCTCC
  AATTTTTGGTGCAATTCAAGGCATTAGAGACAGACTGGAGAAGCGGTACATTGCTGCTTACTTAGCACTC
  ACAGTGGTAGGAATGGGATCCTGGTGTTTCCACATGACTCTGAAATATGAAATGCAGCTGTTGGATGAGC
  TCCCCATGATTTACAGCTGCTGCATATTTGTATACTGCATGTTTGAGTGTTTCAAGACAAAGAGCTCAAT
  AAACTACCATCTTCTTTTTACCCTATTTCTATACAGTTTAACAGTAACTACGATTTACCTAAAAGTCAAA
  GAACCTATATTCCATCAGGTCATGTATGGAATGTTGGTCTTTACATTAGTACTTCGTTCTATTTATATTG
  TTACATGTGTATCTCCAGAGTCTTGTCTGTAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201511 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPAVDRKGYWGPTTSTLDWCEENYVVTLFVAEFWNTVSNLIMIIPPIFGAIQGIRDRLEKRYIAAYLAL
  TVVGMGSWCFHMTLKYEMQLLDELPMIYSCCIFVYCMFECFKTKSSINYHLLFTLFLYSLTVTTIYLKVK
  EPIFHQVMYGMLVFTLVLRSIYIVTCVSPESCLY
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC023924
• ORF Size: 522 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: BC023924, AAH23924
• RefSeq Size: 1460 bp
• RefSeq ORF: 524 bp
• Locus ID: 66190
• Cytogenetics: 7 E1
• MW: 20.3 kDa
• Gene Summary: Endoplasmic reticulum and Golgi ceramidase that catalyzes the hydrolysis of unsaturated long-chain C18:1-, C20:1- and C20:4-ceramides, dihydroceramides and phytoceramides into sphingoid bases like sphingosine and free fatty acids at alkaline pH (PubMed:26474409). Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis and differentiation (PubMed:26474409). Controls the generation of sphingosine in erythrocytes, and thereby sphingosine-1-phosphate in plasma (By similarity). Through the regulation of ceramides and sphingosine-1-phosphate homeostasis in the brain may play a role in neurons survival and function (PubMed:26474409). By regulating the levels of proinflammatory ceramides in immune cells and tissues, may modulate the inflammatory response (PubMed:26938296).[UniProtKB/Swiss-Prot Function]