Ube2d1 (NM_145420) Mouse Tagged ORF Clone

CAT#: MR200998

Ube2d1 (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2D 1, UBC4/5 homolog (yeast) (Ube2d1)

Product Images

Circular map for MR200998

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Ube2d1
• Synonyms: UBCH5
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200998 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGCTGAAGCGGATCCAGAAAGAATTAAGTGATTTACAGCGTGATCCACCTGCCCACTGCTCAGCGG
  GACCCGTGGGAGATGACTTGTTCCACTGGCAAGCAACCATCATGGGGCCCCCTGACAGCGCCTATCAAGG
  TGGAGTCTTCTTCCTCACTGTCCACTTTCCGACAGACTATCCCTTTAAACCACCAAAGATTGCTTTCACA
  ACAAAAATCTACCACCCAAATATAAACAGCAACGGGAGTATTTGTCTTGACATCCTGAGGTCCCAGTGGT
  CGCCCGCTTTGACTGTATCGAAAGTCTTGCTGTCCATATGCTCGCTGCTCTGTGATCCTAATCCAGACGA
  TCCCTTAGTACCAGATATTGCACAGATCTATAAATCAGACAAAGAAAAATACAACAGGCACGCAAGAGAA
  TGGACTCAGAAATATGCAATG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200998 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT
  TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE
  WTQKYAM
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_145420
• ORF Size: 444 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_145420.2
• RefSeq Size: 1448 bp
• RefSeq ORF: 444 bp
• Locus ID: 216080
• UniProt ID: P61080
• Cytogenetics: 10 B5.3
• MW: 16.6 kDa
• Gene Summary: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6 and TRIM63/MURF1. Ubiquitinates STUB1-associated HSP90AB1 in vitro. Lacks inherent specificity for any particular lysine residue of ubiquitin. Essential for viral activation of IRF3. Mediates polyubiquitination of CYP3A4.[UniProtKB/Swiss-Prot Function]