Ppp3r1 (BC002267) Mouse Tagged ORF Clone
CAT#: MR200485
- TrueORF®
Ppp3r1 (Myc-DDK-tagged) - Mouse protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I) (cDNA clone MGC:7652
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"BC002267" in other vectors (5)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Ppp3r1 |
Synonyms | MCIP1, Cnb1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200485 representing BC002267
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200485 representing BC002267
Red=Cloning site Green=Tags(s) MSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELF QVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVSE myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | BC002267 |
ORF Size | 347 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | BC002267 |
RefSeq Size | 802 bp |
RefSeq ORF | 347 bp |
Locus ID | 19058 |
Cytogenetics | 11 A2 |
MW | 29.4 kDa |
Gene Summary | Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC200190 | Ppp3r1 (untagged) - Mouse protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I) (cDNA clone MGC:7652, (10ug) |
USD 300.00 |
|
MC207068 | Ppp3r1 (untagged) - Mouse protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I) (cDNA clone MGC:7652, (10ug) |
USD 330.00 |
|
MG200485 | Ppp3r1 (tGFP-tagged) - Mouse protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I) (cDNA clone MGC:7652 |
USD 365.00 |
|
MR200485L3 | Lenti ORF clone of Ppp3r1 (Myc-DDK-tagged) - Mouse protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I) (cDNA clone MGC:7652 |
USD 465.00 |
|
MR200485L4 | Lenti ORF clone of Ppp3r1 (mGFP-tagged) - Mouse protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I) (cDNA clone MGC:7652 |
USD 465.00 |
{0} Product Review(s)
Be the first one to submit a review