Eny2 (NM_175009) Mouse Tagged ORF Clone
CAT#: MR200314
- TrueORF®
Eny2 (Myc-DDK-tagged) - Mouse enhancer of yellow 2 homolog (Drosophila) (Eny2)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_175009" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Eny2 |
Synonyms | 1810057B09Rik; 6720481I12; DC6; Ey2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200314 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGGTTAGCAAGATGAACAAAGATGCGCAGATGAGAGCAGCGATTAACCAAAAGTTAATAGAAACTG GAGAAAGAGAACGCCTCAAAGAGTTGCTGAGAGCTAAATTAATTGAGTGCGGCTGGAAGGATCAGCTAAA GGCACACTGTAAAGAGGTAATTAAAGAAAAAGGACTAGAACACGTTACTGTTGATGACTTGGTGGCTGAA ATCACTCCAAAAGGCAGAGCCCTGGTACCTGACAGTGTAAAGAAGGAGCTCCTACAGAGAATAAGAACAT TCCTTGCTCAGCATGCCAGTCTT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200314 protein sequence
Red=Cloning site Green=Tags(s) MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAE ITPKGRALVPDSVKKELLQRIRTFLAQHASL myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_175009 |
ORF Size | 306 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_175009.1, NM_175009.2, NM_175009.3, NP_778174.1 |
RefSeq Size | 2429 bp |
RefSeq ORF | 306 bp |
Locus ID | 223527 |
UniProt ID | Q9JIX0 |
Cytogenetics | 15 B3.2 |
MW | 11.5 kDa |
Gene Summary | Involved in mRNA export coupled transcription activation by association with both the TREX-2 and the SAGA complexes. The transcription regulatory histone acetylation (HAT) complex SAGA is a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC202310 | Eny2 (untagged) - Mouse enhancer of yellow 2 homolog (Drosophila) (Eny2), (10ug) |
USD 150.00 |
|
MG200314 | Eny2 (tGFP-tagged) - Mouse enhancer of yellow 2 homolog (Drosophila) (Eny2) |
USD 350.00 |
|
MR200314L3 | Lenti ORF clone of Eny2 (Myc-DDK-tagged) - Mouse enhancer of yellow 2 homolog (Drosophila) (Eny2) |
USD 450.00 |
|
MR200314L4 | Lenti ORF clone of Eny2 (mGFP-tagged) - Mouse enhancer of yellow 2 homolog (Drosophila) (Eny2) |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review