Ap4s1 (BC001985) Mouse Tagged ORF Clone
CAT#: MR200300
- TrueORF®
Ap4s1 (Myc-DDK-tagged) - Mouse adaptor-related protein complex AP-4, sigma 1 (cDNA clone MGC:5660 IMAGE:3495981)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"BC001985" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Ap4s1 |
Synonyms | AI314282 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200300 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATCAAGTTTTTCCTTATGGTGAACAAGCAAGGGCAGACCCGACTGTCTAAGTACTACGAGCATGTGG ACATTAATAAACGTGCGCTTCTGGAGACTGAGGTCAGCAAGAGTTGCCTGTCTCGGTCCAGCGAACAATG CTCATTCATTGAATACAAGGATTTTAAACTGATCTACCGGCAATATGCAGCTCTCTTTGTTGTGGTTGGA GTTAATGACACTGAGAATGAGATGGCTATCTATGAATTTATACACAATTTTGTGGAAGTTTTAGATGGGT ACTTCAGCCGAGTGAGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200300 protein sequence
Red=Cloning site Green=Tags(s) MIKFFLMVNKQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVG VNDTENEMAIYEFIHNFVEVLDGYFSRVS myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | BC001985 |
ORF Size | 297 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | BC001985, AAH01985 |
RefSeq Size | 879 bp |
RefSeq ORF | 299 bp |
Locus ID | 11782 |
Cytogenetics | 12 B3 |
MW | 11.7 kDa |
Gene Summary | This gene encodes the sigma subunit of the adaptor-related protein complex 4 which mediates intracellular membrane trafficking along the endocytic and secretory transport pathways. This complex contains four subunits, beta, epsilon, mu, and sigma, and belongs to a family of five adapter protein complexes, including three clathrin-associated complexes and two non clathrin-associated complexes, that localize to different intracellular compartments and mediate membrane vesicle trafficking using distinct pathways. In humans, loss-of-function mutations in this gene have been linked to specific adapter complex 4 deficiency disorders including hereditary spastic paraplegia. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC200180 | Ap4s1 (untagged) - Mouse adaptor-related protein complex AP-4, sigma 1 (cDNA clone MGC:5660 IMAGE:3495981), (10ug) |
USD 150.00 |
|
MG200300 | Ap4s1 (tGFP-tagged) - Mouse adaptor-related protein complex AP-4, sigma 1 (cDNA clone MGC:5660 IMAGE:3495981) |
USD 350.00 |
|
MR200300L3 | Lenti ORF clone of Ap4s1 (Myc-DDK-tagged) - Mouse adaptor-related protein complex AP-4, sigma 1 (cDNA clone MGC:5660 IMAGE:3495981) |
USD 450.00 |
|
MR200300L4 | Lenti ORF clone of Ap4s1 (mGFP-tagged) - Mouse adaptor-related protein complex AP-4, sigma 1 (cDNA clone MGC:5660 IMAGE:3495981) |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review