Arg1 (NM_007482) Mouse Tagged ORF Clone

CAT#: MG204674

Arg1 (GFP-tagged) - Mouse arginase 1, liver (Arg1)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Arg1 (NM_007482) Mouse Tagged ORF Clone
Symbol Arg1
Synonyms AI; AI256583; Arg-1; PGIF
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>MG204674 representing NM_007482
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTCCAAGCCAAAGTCCTTAGAGATTATCGGAGCGCCTTTCTCAAAAGGACAGCCTCGAGGAGGGG
TAGAGAAAGGCCCTGCAGCACTGAGGAAAGCTGGTCTGCTGGAAAAACTTAAAGAAACAGAGTATGACGT
GAGAGACCACGGGGACCTGGCCTTTGTTGATGTCCCTAATGACAGCTCCTTTCAAATTGTGAAGAACCCA
CGGTCTGTGGGGAAAGCCAATGAAGAGCTGGCTGGTGTGGTGGCAGAGGTCCAGAAGAATGGAAGAGTCA
GTGTGGTGCTGGGTGGAGACCACAGTCTGGCAGTTGGAAGCATCTCTGGCCACGCCAGGGTCCACCCTGA
CCTATGTGTCATTTGGGTGGATGCTCACACTGACATCAACACTCCCCTGACAACCAGCTCTGGGAATCTG
CATGGGCAACCTGTGTCCTTTCTCCTGAAGGAACTGAAAGGAAAGTTCCCAGATGTACCAGGATTCTCCT
GGGTGACTCCCTGCATATCTGCCAAAGACATCGTGTACATTGGCTTGCGAGACGTAGACCCTGGGGAACA
CTATATAATAAAAACTCTGGGAATTAAGTATTTCTCCATGACTGAAGTAGACAAGCTGGGGATTGGCAAG
GTGATGGAAGAGACCTTCAGCTACCTGCTGGGAAGGAAGAAAAGGCCGATTCACCTGAGCTTTGATGTCG
ATGGGCTGGACCCAGCATTCACCCCGGCGACCGGCACCCCGGTTCTGGGAGGCCTATCTTACAGAGAAGG
TCTCTACATCACAGAAGAAATTTACAAGACAGGGCTCCTTTCAGGACTAGATATCATGGAAGTGAACCCA
ACTCTTGGGAAGACAGCAGAGGAGGTGAAGAGTACTGTGAACACGGCAGTGGCTTTAACCTTGGCTTGTT
TCGGAACTCAACGGGAGGGTAACCATAAGCCAGGGACTGACTACCTTAAACCACCTAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MR204674 representing NM_007482
Red=Cloning site Green=Tags(s)

MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNP
RSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNL
HGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGK
VMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNP
TLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_007482
ORF Size 969 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007482.2, NP_031508
RefSeq Size 1453
RefSeq ORF 972
Locus ID 11846
Cytogenetics 10|10 A4
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)