Products

cDNA Clones (7)
Proteins (3)
Antibodies (1)
Jump to Filters
View as table Download
CALML6 (NM_138705) Human Tagged ORF Clone
RC222115

USD 300.00

In Stock

CALML6 (Myc-DDK-tagged)-Human calmodulin-like 6 (CALML6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CALML6 (NM_138705) Human Tagged ORF Clone Lentiviral Particle
RC222115L3V

USD 850.00

7 Weeks

Lenti ORF particles, CALML6 (Myc-DDK tagged) - Human calmodulin-like 6 (CALML6), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CALML6 (NM_138705) Human Tagged ORF Clone Lentiviral Particle
RC222115L4V

USD 850.00

7 Weeks

Lenti ORF particles, CALML6 (mGFP-tagged) - Human calmodulin-like 6 (CALML6), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CALML6 (NM_138705) Human Tagged ORF Clone
RG222115

USD 500.00

3 Weeks

CALML6 (tGFP-tagged) - Human calmodulin-like 6 (CALML6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CALML6 (NM_138705) Human Tagged Lenti ORF Clone
RC222115L3

USD 600.00

3 Weeks

Lenti ORF clone of Human calmodulin-like 6 (CALML6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CALML6 (NM_138705) Human Tagged Lenti ORF Clone
RC222115L4

USD 600.00

3 Weeks

Lenti ORF clone of Human calmodulin-like 6 (CALML6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CALML6 Rabbit Polyclonal Antibody
TA331664

USD 539.00

5 Days

Rabbit Polyclonal Anti-CALML6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CALML6 Antibody is: synthetic peptide directed towards the C-terminal region of Human CALML6. Synthetic peptide located within the following region: YHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQ
CALML6 (NM_138705) Human Over-expression Lysate
LC408555

USD 134.00

2 Weeks

CALML6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CALML6 (NM_138705) Human Over-expression Lysate
LY408555

USD 436.00

5 Days

Transient overexpression lysate of calmodulin-like 6 (CALML6)

Tag C-Myc/DDK
Expression Host HEK293T
CALML6 (NM_138705) Human Untagged Clone
SC306064

USD 330.00

3 Weeks

CALML6 (untagged)-Human calmodulin-like 6 (CALML6)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CALML6 CytoSection
TS422115P5

USD 1,174.00

4 Weeks

Transient overexpression of CALML6 in HEK293T cells, FFPE control for IHC, ICC and ISH staining, 25 slides per pack

Other Names CAGLP
Accession Number NM_138705, NP_619650