Germany
Japan
United Kingdom
China
CACNG4 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CACNG4 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, CACNG4 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, CACNG4 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, CACNG4 (mGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
CACNG4 (tGFP-tagged) - Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Purified recombinant protein of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4)
| Tag | N-GST and C-HIS |
| Expression Host | E. coli |
CACNG4 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human CACNG4 |
CACNG4 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal Anti-CACNG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Rabbit Polyclonal Anti-CACNG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Active filters
Target Symbol
- CACNG4
Pathways
- Cardiac muscle contraction