Products

View as table Download

Anti-COX6B1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal antibody to COX6B1 (cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous))

Applications IF, IHC, WB
Reactivities Human (Predicted: Bovine, Rhesus Monkey, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 23 and 86 of COX6B1 (Uniprot ID#P14854)

Cytochrome C Oxidase subunit VIb (COX6B1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 58-86 amino acids from the C-terminal region of human COX6B1

Rabbit Polyclonal Anti-COX6B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-COX6B1 antibody is: synthetic peptide directed towards the N-terminal region of Human COX6B1. Synthetic peptide located within the following region: TAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQS

COX6B1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human COX6B1