Products

cDNA Clones (21)
Antibodies (10)
Proteins (10)
Jump to Filters
View as table Download
LYN (NM_001111097) Human Tagged ORF Clone
RC225842

USD 686.00

In Stock

LYN (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LYN (NM_001111097) Human Tagged ORF Clone Lentiviral Particle
RC225842L3V

USD 1,236.00

7 Weeks

Lenti ORF particles, LYN (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

LYN (NM_001111097) Human Tagged ORF Clone Lentiviral Particle
RC225842L4V

USD 1,236.00

2 Weeks

Lenti ORF particles, LYN (mGFP-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

LYN (NM_002350) Human Tagged ORF Clone
RC212851

USD 715.00

In Stock

LYN (Myc-DDK-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LYN (NM_002350) Human Tagged ORF Clone
RG212851

USD 915.00

In Stock

LYN (tGFP-tagged) - Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LYN (NM_001111097) Human Recombinant Protein
TP325842

USD 867.00

In Stock

Purified recombinant protein of Homo sapiens v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2, 20 µg

Tag C-Myc/DDK
Expression Host HEK293T
LYN (NM_001111097) Human Recombinant Protein
TP325842L

USD 9,200.00

6 Weeks

Purified recombinant protein of Homo sapiens v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2, 1 mg

Tag C-Myc/DDK
Expression Host HEK293T
LYN (NM_001111097) Human Recombinant Protein
TP325842M

USD 2,950.00

6 Weeks

Purified recombinant protein of Homo sapiens v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2, 100 µg

Tag C-Myc/DDK
Expression Host HEK293T
LYN (NM_002350) Human Mutant ORF Clone
RC402618

USD 450.00

2 Weeks

LYN Mutant (Y306X), Myc-DDK-tagged ORF clone of Homo sapiens v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1 as transfection-ready DNA

Mutation Y306X
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LYN (NM_001111097) Human Tagged ORF Clone
RG225842

USD 886.00

3 Weeks

LYN (tGFP-tagged) - Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LYN Rabbit Polyclonal Antibody
TA350146

USD 380.00

In Stock

Rabbit Polyclonal Anti-LYN Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LYN
LYN Rabbit Polyclonal Antibody
TA324977

USD 580.00

5 Days

Rabbit polyclonal LYN Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This LYN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 32-62 amino acids from the N-terminal region of human LYN.
LYN Rabbit Polyclonal Antibody
TA335063

USD 539.00

5 Days

Rabbit Polyclonal Anti-LYN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-LYN antibody: synthetic peptide directed towards the N terminal of human LYN. Synthetic peptide located within the following region: DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF
LYN (NM_002350) Human Tagged Lenti ORF Clone
RC212851L2

USD 1,015.00

In Stock

Lenti-ORF clone of LYN (mGFP-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LYN (NM_001111097) Human Tagged Lenti ORF Clone
RC225842L4

USD 986.00

In Stock

Lenti-ORF clone of LYN (mGFP-tagged)-Human v-yes-1 Yamaguchi sarcoma viral related oncogene homolog (LYN), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®