Products

Proteins (21)
cDNA Clones (20)
Antibodies (1)
Jump to Filters
View as table Download
Parvin gamma (PARVG) (NM_001137605) Human Recombinant Protein
TP326988M

USD 2,950.00

6 Weeks

Recombinant protein of human parvin, gamma (PARVG), transcript variant 2, 100 µg

Tag C-Myc/DDK
Expression Host HEK293T
Parvin gamma (PARVG) (NM_001137606) Human Recombinant Protein
TP327051L

USD 9,200.00

6 Weeks

Recombinant protein of human parvin, gamma (PARVG), transcript variant 3, 1 mg

Tag C-Myc/DDK
Expression Host HEK293T
Parvin gamma (PARVG) (NM_001137606) Human Recombinant Protein
TP327051M

USD 2,950.00

6 Weeks

Recombinant protein of human parvin, gamma (PARVG), transcript variant 3, 100 µg

Tag C-Myc/DDK
Expression Host HEK293T
Parvin gamma (PARVG) (NM_022141) Human Tagged ORF Clone
RG206755

USD 500.00

3 Weeks

PARVG (tGFP-tagged) - Human parvin, gamma (PARVG), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Parvin gamma (PARVG) (NM_001137605) Human Tagged ORF Clone
RG226988

USD 500.00

3 Weeks

PARVG (tGFP-tagged) - Human parvin, gamma (PARVG), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Parvin gamma (PARVG) (NM_001137606) Human Tagged ORF Clone
RG227051

USD 500.00

3 Weeks

PARVG (tGFP-tagged) - Human parvin, gamma (PARVG), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Parvin gamma (PARVG) Rabbit Polyclonal Antibody
TA344693

USD 539.00

5 Days

Rabbit Polyclonal Anti-PARVG Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PARVG antibody is: synthetic peptide directed towards the N-terminal region of Human PARVG. Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA
Parvin gamma (PARVG) (NM_022141) Human Over-expression Lysate
LC411746

USD 134.00

2 Weeks

PARVG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Parvin gamma (PARVG) (NM_001137605) Human Over-expression Lysate
LC427944

USD 134.00

2 Weeks

PARVG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Parvin gamma (PARVG) (NM_001137606) Human Over-expression Lysate
LC427945

USD 134.00

2 Weeks

PARVG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Parvin gamma (PARVG) (NM_022141) Human Over-expression Lysate
LY411746

USD 436.00

5 Days

Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB