Parvin gamma (PARVG) Rabbit Polyclonal Antibody

CAT#: TA344693

Rabbit Polyclonal Anti-PARVG Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: PARVG; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PARVG antibody is: synthetic peptide directed towards the N-terminal region of Human PARVG. Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: parvin gamma
• Database Link:
  NP_071424
  Entrez Gene 64098 Human
  UniProt ID Q9HBI0
• Background: Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.
• Synonyms: AI413459; gamma; gamma-parvin; OTTMUSP00000032048; parvin
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 93%

Reference Data

• Protein Pathways: Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Tight junction, Vibrio cholerae infection, Viral myocarditis