CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CLDN18 (tGFP-tagged) - Human claudin 18 (CLDN18), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Claudin18.2(CLDN18.2) Rabbit monoclonal antibody,clone OTIR56A8
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CLDN18 (tGFP-tagged) - Human claudin 18 (CLDN18), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 1,000.00
2 Weeks
Lenti ORF particles, CLDN18 (Myc-DDK tagged) - Human claudin 18 (CLDN18), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti-ORF clone of CLDN18 (mGFP-tagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of CLDN18 (mGFP-tagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human claudin 18 (CLDN18), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CLDN18 (Myc-DDK-tagged)-Human claudin 18 (CLDN18), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human claudin 18 (CLDN18), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human claudin 18 (CLDN18), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 1,000.00
4 Weeks
Lenti ORF particles, CLDN18 (mGFP-tagged) - Human claudin 18 (CLDN18), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Rabbit Polyclonal Anti-CLDN18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM |