SLC8A1 (Myc-DDK-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant A
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
SLC8A1 (Myc-DDK-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant A
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SLC8A1 (tGFP-tagged) - Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant D
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SLC8A1 (Myc-DDK-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant B
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SLC8A1 (Myc-DDK-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant D
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SLC8A1 (Myc-DDK-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant C
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SLC8A1 (Myc-DDK tagged) - Homo sapiens solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant E
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SLC8A1 (tGFP-tagged) - Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant C
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SLC8A1 (tGFP-tagged) - Homo sapiens solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant E
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SLC8A1 (tGFP-tagged) - Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant A
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SLC8A1 (tGFP-tagged) - Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant B
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of SLC8A1 (mGFP-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant B
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,436.00
4 Weeks
Lenti ORF particles, SLC8A1 (mGFP-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant B, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Rabbit Polyclonal Anti-SLC8A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC8A1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SLC8A1. Synthetic peptide located within the following region: CTGSYYCKKGVILPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADR |
Lenti ORF clone of Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant A, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant A, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |