Products

View as table Download

SLC8A1 (Myc-DDK-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant A

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SLC8A1 (tGFP-tagged) - Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant D

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SLC8A1 (Myc-DDK-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant B

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SLC8A1 (Myc-DDK-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant D

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SLC8A1 (Myc-DDK-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant C

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SLC8A1 (Myc-DDK tagged) - Homo sapiens solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant E

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

SLC8A1 (tGFP-tagged) - Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant C

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SLC8A1 (tGFP-tagged) - Homo sapiens solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant E

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SLC8A1 (tGFP-tagged) - Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant A

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SLC8A1 (tGFP-tagged) - Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant B

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of SLC8A1 (mGFP-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant B

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SLC8A1 (mGFP-tagged)-Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Rabbit Polyclonal Anti-SLC8A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC8A1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SLC8A1. Synthetic peptide located within the following region: CTGSYYCKKGVILPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADR

Lenti ORF clone of Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant A, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human solute carrier family 8 (sodium/calcium exchanger), member 1 (SLC8A1), transcript variant A, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®