Mouse Monoclonal VEGF Antibody (VG1)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Canine |
Conjugation | Unconjugated |
Mouse Monoclonal VEGF Antibody (VG1)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Canine |
Conjugation | Unconjugated |
Rabbit Polyclonal SEMA3B Antibody
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200). |
Mouse Monoclonal AG-2 Antibody (10E2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Canine, Equine, Primate |
Conjugation | Unconjugated |
DNase I (DNASE1) (1-252) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Canine, Human, Rabbit |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 252 of DNase I. |
Pancreatic Polypeptide (PPY) (61-73) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Canine, Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from the internal region of of Human PPY (NP_002713.1) |
Goat Polyclonal Anti-VEGFA Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human VEGFA isoform 6 produced in E. coli. |
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from an internal region of human WNT3 |
Glutathione Peroxidase 3 (GPX3) (102-114) goat polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Equine, Monkey, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from internal region of human GPX3 |
Clusterin (CLU) (488-501) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from the C-terminus of human CLU/Clusterin (NP_001822.2; NP_976084.1). |
IGFBP6 (128-141) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Canine, Equine, Human, Monkey, Sheep, Bear |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from an internal region of human IGFBP6 |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
Applications | IHC, WB |
Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-NUCB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Canine |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
Apolipoprotein H (APOH) goat polyclonal antibody, Aff - Purified
Applications | ELISA, ID, IHC |
Reactivities | Canine, Human, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Purified beta2-Glycoprotein-I (beta2GP-I) from human plasma. This protein is also known as apolipoprotein-H. |
TPSAB1 mouse monoclonal antibody, clone AA1, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Canine, Feline, Human, Monkey, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-IL10 Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse, Canine, Monkey |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human IL10 produced in E. coli. |