Research Areas

cDNA Clones (32)
Antibodies (11)
Proteins (10)
Jump to Filters
View as table Download
LEF1 (NM_001166119) Human Tagged ORF Clone
RG228237

USD 650.00

In Stock

LEF1 (tGFP-tagged) - Human lymphoid enhancer-binding factor 1 (LEF1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LEF1 (NM_016269) Human Recombinant Protein
TP760177

USD 261.00

In Stock

Recombinant protein of human lymphoid enhancer-binding factor 1 (LEF1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
LEF1 (NM_001166119) Human Tagged ORF Clone
RC228237

USD 450.00

In Stock

LEF1 (Myc-DDK-tagged)-Human lymphoid enhancer-binding factor 1 (LEF1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LEF1 (NM_016269) Human Tagged ORF Clone
RG208663

USD 886.00

In Stock

LEF1 (tGFP-tagged) - Human lymphoid enhancer-binding factor 1 (LEF1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LEF1 (NM_001130713) Human Tagged ORF Clone
RG225565

USD 886.00

In Stock

LEF1 (tGFP-tagged) - Human lymphoid enhancer-binding factor 1 (LEF1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LEF1 (NM_001130714) Human Tagged ORF Clone
RG225588

USD 886.00

In Stock

LEF1 (tGFP-tagged) - Human lymphoid enhancer-binding factor 1 (LEF1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LEF1 Mouse Monoclonal Antibody [Clone ID: OTI10A7]
TA812988S

USD 200.00

2 Days

LEF1 mouse monoclonal antibody,clone OTI10A7

Applications IF, IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

LEF1 (NM_016269) Human Tagged Lenti ORF Clone
RC208663L1

USD 986.00

In Stock

Lenti ORF clone of Human lymphoid enhancer-binding factor 1 (LEF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
LEF1 (NM_016269) Human Untagged Clone
SC114370

USD 686.00

In Stock

LEF1 (untagged)-Human lymphoid enhancer-binding factor 1 (LEF1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
LEF1 (NM_016269) Human Tagged Lenti ORF Clone
RC208663L4

USD 986.00

In Stock

Lenti ORF clone of Human lymphoid enhancer-binding factor 1 (LEF1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LEF1 (NM_001130714) Human Tagged Lenti ORF Clone
RC225588L4

USD 986.00

In Stock

Lenti-ORF clone of LEF1 (mGFP-tagged)-Human lymphoid enhancer-binding factor 1 (LEF1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LEF1 Rabbit Polyclonal Antibody
TA330286

USD 485.00

5 Days

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ
LEF1 Rabbit Polyclonal Antibody
TA349379

USD 380.00

In Stock

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LEF1
LEF1 Rabbit Polyclonal Antibody
TA324467

USD 580.00

5 Days

Rabbit polyclonal LEF1 Antibody (N-term)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1.