Mouse Monoclonal c-Myc Antibody (9E10)
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Sandwich ELISA, Simple Western, WB |
Reactivities | Human, Mouse, Drosophila |
Conjugation | Unconjugated |
Mouse Monoclonal c-Myc Antibody (9E10)
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Sandwich ELISA, Simple Western, WB |
Reactivities | Human, Mouse, Drosophila |
Conjugation | Unconjugated |
Rabbit Polyclonal Calnexin Antibody
Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
Mouse Monoclonal PCNA Antibody (PC10)
Applications | ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Chicken, Drosophila, Human, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
Tubulin (TUBA1B) rat monoclonal antibody, clone YOL1/34, Purified
Applications | ELISA, IF, IHC, IP, R, WB |
Reactivities | Human, Mammalian, Mouse, Rat, Yeast, Birds, Drosophila |
Conjugation | Unconjugated |
Mouse Monoclonal Cytochrome c Antibody (7H8.2C12)
Applications | FC, ICC/IF, IHC, Immunoblotting, WB |
Reactivities | Human, Mouse, Canine, Drosophila, Equine, Mammalian |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
Applications | IF, IHC, WB |
Reactivities | Human, Drosophila, Rat, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, C. elegans) |
Conjugation | Unconjugated |
Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
Mouse Monoclonal SIAH2 Antibody (24E6H3)
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Drosophila, Porcine (Does not react with: Mouse) |
Conjugation | Unconjugated |
G0 Protein alpha (GNAO1) (345-354) rabbit polyclonal antibody, Ig Fraction
Applications | ELISA, IHC, WB |
Reactivities | Mouse, Drosophila |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide KLH- conjugated corresponding to amino acids 345-354 of the native molecule |
Rabbit Polyclonal Antibody against CDC2 (T14)
Applications | IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, Xenopus) |
Conjugation | Unconjugated |
Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
Mouse monoclonal Hsp60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila, Guinea Pig, Monkey, Pig, Rabbit, Sheep, Xenopus, Hamster |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TUBE1 Antibody - middle region
Applications | IHC, WB |
Reactivities | Drosophila, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA |
GRP94 (HSP90B1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Chicken, Drosophila, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide. |