Germany
Japan
United Kingdom
China
Research Areas
View as table Download
Rabbit Polyclonal Calnexin Antibody
| Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
| Applications | IF, IHC, WB |
| Reactivities | Human, Drosophila, Rat, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, C. elegans) |
| Conjugation | Unconjugated |
| Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
Rabbit Polyclonal Antibody against CDC2 (T14)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
Rabbit Polyclonal Anti-TUBE1 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Drosophila, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA |
GRP94 (HSP90B1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Chicken, Drosophila, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide. |
Active filters
Category
- Antibodies
Reactivities
- Drosophila
Applications
- IHC
Families
- Druggable Genome
Filter by
Target Symbol
Antibody Hosts
Clonalities
Conjugates
Assay Types
Pathways
- Cell cycle (3)
- Gap junction (3)
- Pathways in cancer (3)
- Colorectal cancer (2)
- Pathogenic Escherichia coli infection (2)
- Small cell lung cancer (2)
- p53 signaling pathway (2)
- Acute myeloid leukemia (1)
- Alzheimer's disease (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Antigen processing and presentation (1)
- Apoptosis (1)
- Base excision repair (1)
- Bladder cancer (1)
- Chronic myeloid leukemia (1)
- DNA replication (1)
- Endometrial cancer (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Huntington's disease (1)
- Jak-STAT signaling pathway (1)
- Long-term depression (1)
- MAPK signaling pathway (1)
- Melanogenesis (1)
- Metabolic pathways (1)
- Mismatch repair (1)
- NOD-like receptor signaling pathway (1)
- Nucleotide excision repair (1)
- Oocyte meiosis (1)
- Oxidative phosphorylation (1)
- Parkinson's disease (1)
- Progesterone-mediated oocyte maturation (1)
- Prostate cancer (1)
- RNA degradation (1)
- TGF-beta signaling pathway (1)
- Thyroid cancer (1)
- Type I diabetes mellitus (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)
- Wnt signaling pathway (1)